Plans: 25% HOURLY For - 5 Hours,36% HOURLY For - 5 Hours,47% HOURLY...
Min deposit: $10
Max deposit: $100000
Referral: 10%
Withdrawal: instant
481 views [3 clicks]Reviews: 000
«Playcoins» summary
This «RiskRank» metric is a general litmus test for the quality of the «Playcoins» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of playcoins.pw and the results from 0 to 10 points.
playcoins.pw good quality signs
The domain playcoins.pw is registered for two years, which is a good thing;
Good hosting ensures the proper response level and excellent website access;
playcoins.pw poor signs
Free SSL without a confidence guarantee;
Many design parts copied from other HYIPs;
IP 198.187.31.243 that occurs elsewhere for 197 HYIP;
Not listed on trusted HYIP monitors;
The website playcoins.pw uses a not licenced script;
0.0
This project is a scam and stops paying on Aug 03, 2019.
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Content
#Tags
Here's what it says on the playcoins.pw website:
playcoins.pw is a global asset management firm founded in 2017 and
manages a team of experienced managers, conducting deep fundamental
research to identify investments trading at material dislocation from
fair value. The key to the investment approach playcoins.pw is expertise
in the identification and assessment of subsequent changes, as they are
often the catalyst for compelling opportunities.
playcoins.pw is committed to provide a high annual return, adjusted for
risk throughout the investment cycle, capturing the greater part up in
strong markets and preserving capital in difficult markets. playcoins.pw
believes that stock selection based on rigorous fundamental analysis
helps to generate positive results for a long time.
The investment team applies intensive analysis and research, to use the
innate inefficiency of the markets in which it operates. playcoins.pw
seeks to identify undervalued investment opportunities, as well as
choose non-correlated and liquid investments that are selected for their
potential to generate alpha. Portfolio construction the strategy seeks
to reduce the impact of market volatility.
global asset management firm foundedinvestment team applies intensive analysisrigorous fundamental analysis helpsconducting deep fundamental researchidentify undervalued investment opportunitiesidentify investments tradingstock selection basedhigh annual returngenerate positive resultsinvestment approach playcoinsinvestment cyclecompelling opportunitiesgenerate alphaliquid investmentspreserving capitalportfolio constructionstrategy seekslong timeinnate inefficiencymarket volatilitygreater partexperienced managersmaterial dislocationstrong marketsdifficult marketspw believespw seeksteamresearchmarketspwplaycoins
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here.
Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.