Plans: 34.00% hourly for 5 hours; 42.00% hourly for 5 hours; 56.00% hourly for 5 hours; 68.00% hourly for 5 hours; 84.00% hourly for 5 hours; 104.00% hourly for 5 hours
Min deposit: $10
Max deposit: $100000
Referral: 10%
Withdrawal: instant
X
This project is a scam and stopped paying on Oct 29, 2020.
«Letfxdo» [letfxdo.pw] Summary
The «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Letfxdo», evaluated based on multiple criteria. Below is a detailed analysis of letfxdo.pw, with a score ranging from 0 to 10 points.
Green flags:
The domain letfxdo.pw is registered for two years, which is a good thing;
Excellent hosting: Very few sites on this IP guarantee superior response times and reliable access;
Red flags:
Free SSL: A basic security certificate provided free of charge for a short period to encrypt data on a website;
Many design parts copied from other HYIPs;
IP 199.188.200.236 that occurs elsewhere for 347 HYIP;
Not featured on reputable HYIP monitoring platforms;
The website letfxdo.pw uses a not licenced script;
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Content
#Tags
Here's what it says on the letfxdo.pw website:
letfxdo.pw is a global asset management firm founded in 2017 and
manages a team of experienced managers, conducting deep fundamental
research to identify investments trading at material dislocation from
fair value. The key to the investment approach letfxdo.pw is expertise
in the identification and assessment of subsequent changes, as they are
often the catalyst for compelling opportunities.
letfxdo.pw is committed to provide a high annual return, adjusted for
risk throughout the investment cycle, capturing the greater part up in
strong markets and preserving capital in difficult markets. letfxdo.pw
believes that stock selection based on rigorous fundamental analysis
helps to generate positive results for a long time.
The investment team applies intensive analysis and research, to use the
innate inefficiency of the markets in which it operates. letfxdo.pw
seeks to identify undervalued investment opportunities, as well as
choose non-correlated and liquid investments that are selected for their
potential to generate alpha. Portfolio construction the strategy seeks
to reduce the impact of market volatility.
global asset management firm foundedinvestment team applies intensive analysisrigorous fundamental analysis helpsconducting deep fundamental researchidentify undervalued investment opportunitiesidentify investments tradingstock selection basedhigh annual returngenerate positive resultsinvestment approach letfxdoinvestment cyclecompelling opportunitiesgenerate alphaliquid investmentspreserving capitalportfolio constructionstrategy seekslong timeinnate inefficiencymarket volatilitygreater partexperienced managersmaterial dislocationstrong marketsdifficult marketspw believespw seeksteamresearchmarketspwletfxdo
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here.
Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.