|
Reviews: 400
 |
[862 views]
[78 clicks] |
|
Transorous.com
Added: Mar 26,2023 13:55
Closed: Apr 07,2023 [12 days]
|
|
|
|
|
Plans: 3.77% daily for 60 days
Min deposit: $1
Max deposit: $∞
Referral: 4 Levels: 7%-3%-2%-1%
Withdrawal: Instant
|
|
This project is a scam and stopped paying on Apr 07, 2023.
|
|
|
«Transorous.com» [transorous.com] SummaryThe «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Transorous.com», evaluated based on multiple criteria. Below is a detailed analysis of transorous.com, with a score ranging from 0 to 10 points.
|
Green flags:
- The website uses Sectigo Limited SSL encryption. All of the incoming and outdoing content is encrypted;
- High-quality hosting: A single site on this IP ensures constant access, top reliability, performance, and security;
- Has a licenced GoldCoders script;
- Featured on a reputable monitoring platforms;
Red flags:
- Plans:1/1 flagged red;
- Plagiarized design elements from other HYIPs;
- IP 185.186.52.92 that occurs elsewhere for 3 HYIP;
Warning! The "transorous.com" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/transorous-transorous-com.680316/ https://pf1.ru/topic60168.html
|
Domain: |
transorous.com is registered for a 1 year
by NameSilo, LLC [from Jan 26,2023 to Jan 26,2024]
|
|
~ |
SSL
valid for a 10 months - Sectigo Limited
|
+ |
Script: GoldCoders - Licensed
|
+ |
Dedicated server
- IP address 185.186.52.92 hosts 1 domain |
+ |
Hosting: Genius-Security-Ltd [ geniusguard.com ]
|
+ |
Network: 185.186.x.x [548 projects]
 |
- |
|
- |
|
Upvega
7114 votes 2 years ago
Profit Hunters
Dep 1.08 LTC 6dc873586bbab36a9177d4f30da71bb70db149f02a41db20fd656a0145931471 Apr-05-2023 00:08 Transorous Инвестирую с PH
lyuba Kulyk
11909 votes 2 years ago
Profit Hunters
Deposit Transorous 100 USDT ceb2715bb379b560c9f195cb3cdbdfa8217e0132baad9b94f5895a6143c9495e 2023-04-05 20:14:21. Инвестирую с Profit-Hunters
Ekaterina Rodina
11849 votes 2 years ago
Profit Hunters
Deposit Transorous 100 USDT 0xa70d41060f49dda8556444b80517ac45a50f1c272723d4cbd9e6b0699a77b416 Apr-04-2023 23:47:59 Инвестирую с блогом Profit-Hunters.
# |
Monitor |
#Pos. |
Status Updated |
Invested |
ROI(%) USD |
Last Payout |
Latest Event |
Added |
|
InvesTracing
|
17 |
not paid
11 Apr 2023
|
$500 |
62%
310 USD |
|
waiting »
not paid2 years ago
|
26 Mar 2023
2 years ago
|
|
InstantMonitor
|
71 |
not paid
10 Apr 2023
|
$500 |
63%
315 USD |
|
waiting »
not paid2 years ago
|
26 Mar 2023
2 years ago
|
05 Apr 2023 RCB |
$100.00 $24.42 |
1 deposit
|
 |
InvesTracing RCB |
$100.00 $24.42 |
1 deposit |
 |
Time |
User |
Deposit / RCB |
Status |
11:42:10 |
Ra* |
$100 / $24.42 |
paid |
04 Apr 2023 RCB |
$750.00 $130.12 |
2 deposits
min: $300
max: $450
avg: $375
|
 |
InstantMonitor RCB |
$750.00 $130.12 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
19:50:28 |
fa* |
$450 / $73.05 |
Paid |
15:29:37 |
Fo* |
$300 / $57.07 |
Paid |
03 Apr 2023 RCB |
$429.00 $97.35 |
5 deposits
min: $50
max: $150
avg: $86
|
 |
InvesTracing RCB |
$229.00 $53.38 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
14:29:50 |
ps* |
$50 / $13.45 |
paid |
01:23:32 |
ke* |
$100 / $23.84 |
paid |
00:14:23 |
go* |
$79 / $16.09 |
paid |
InstantMonitor RCB |
$200.00 $43.97 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
18:11:00 |
ga* |
$150 / $29.65 |
Paid |
14:08:03 |
sg* |
$50 / $14.32 |
Paid |
02 Apr 2023 RCB |
$370.00 $87.21 |
4 deposits
min: $20
max: $200
avg: $93
|
 |
InvesTracing RCB |
$370.00 $87.21 |
4 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
23:31:06 |
li* |
$200 / $40.04 |
paid |
23:24:22 |
ja* |
$50 / $14.47 |
paid |
17:37:04 |
ze* |
$100 / $27.42 |
paid |
11:11:25 |
to* |
$20 / $5.28 |
paid |
01 Apr 2023 RCB |
$320.00 $81.63 |
3 deposits
min: $100
max: $120
avg: $107
|
 |
InstantMonitor RCB |
$320.00 $81.63 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
04:21:03 |
gi* |
$100 / $26.37 |
Paid |
01:35:57 |
Ta* |
$120 / $28.89 |
Paid |
00:16:14 |
mu* |
$100 / $26.37 |
Paid |
31 Mar 2023 RCB |
$180.00 $39.56 |
2 deposits
min: $50
max: $130
avg: $90
|
 |
InstantMonitor RCB |
$180.00 $39.56 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
12:14:17 |
ro* |
$130 / $26.22 |
Paid |
08:11:38 |
ma* |
$50 / $13.34 |
Paid |
30 Mar 2023 RCB |
$450.00 $88.96 |
3 deposits
min: $100
max: $200
avg: $150
|
 |
InstantMonitor RCB |
$450.00 $88.96 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
21:44:24 |
My* |
$100 / $22.93 |
Paid |
14:07:55 |
Ja* |
$200 / $37.71 |
Paid |
14:03:42 |
Bo* |
$150 / $28.32 |
Paid |
29 Mar 2023 RCB |
$120.00 $25.01 |
2 deposits
min: $20
max: $100
avg: $60
|
 |
InvesTracing RCB |
$120.00 $25.01 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
19:56:27 |
va* |
$20 / $4.59 |
paid |
11:42:50 |
ti* |
$100 / $20.42 |
paid |
28 Mar 2023 RCB |
$500.00 $98.00 |
4 deposits
min: $100
max: $150
avg: $125
|
 |
InstantMonitor RCB |
$500.00 $98.00 |
4 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
10:36:29 |
va* |
$150 / $27.22 |
Paid |
09:54:48 |
ki* |
$100 / $21.53 |
Paid |
05:21:08 |
pa* |
$150 / $27.22 |
Paid |
01:15:11 |
be* |
$100 / $22.03 |
Paid |
27 Mar 2023 RCB |
$111.00 $21.53 |
3 deposits
min: $30
max: $50
avg: $37
|
 |
InvesTracing RCB |
$111.00 $21.53 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
20:05:29 |
ni* |
$50 / $10.41 |
paid |
07:39:23 |
Mo* |
$31 / $5.6 |
paid |
02:38:12 |
Ab* |
$30 / $5.52 |
paid |
26 Mar 2023 RCB |
$1,137.00 $238.67 |
14 deposits
min: $30
max: $300
avg: $82
|
 |
InstantMonitor RCB |
$600.00 $124.47 |
5 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
22:33:47 |
ri* |
$300 / $51.69 |
Paid |
19:59:44 |
ba* |
$50 / $12.59 |
Paid |
19:42:55 |
Ef* |
$50 / $13.09 |
Paid |
18:17:07 |
du* |
$100 / $23.55 |
Paid |
18:17:07 |
du* |
$100 / $23.55 |
Pending |
InvesTracing RCB |
$537.00 $114.20 |
9 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
21:30:34 |
mo* |
$100 / $20.01 |
paid |
16:45:57 |
im* |
$70 / $13.32 |
paid |
15:59:28 |
ua* |
$30 / $6.35 |
paid |
15:55:41 |
Mo* |
$42 / $8.64 |
suspended |
15:47:30 |
10* |
$100 / $20.01 |
paid |
15:11:32 |
ko* |
$30 / $7 |
paid |
14:32:28 |
gc* |
$50 / $11.33 |
paid |
14:21:04 |
je* |
$77 / $15.36 |
paid |
14:19:07 |
He* |
$50 / $12.32 |
paid |
13:57:34 |
ma* |
$30 / $8.5 |
paid |
|
Summary of Deposits updated: Apr 07,2023 18:46:02 |
InstantMonitor
RCB
|
$3,000.00
$606.71
|
21 deposits
min: $50
max: $450
avg: $143
|
 |
Top 10 Deposits |
Users with multiple deposits: 1 |
Time |
User |
Deposit / RCB |
Status |
Apr 04,2023 19:50:28 |
fa*** |
$450 / $73.05 |
Paid |
Mar 26,2023 22:33:47 |
ri*** |
$300 / $51.69 |
Paid |
Apr 04,2023 15:29:37 |
Fo*** |
$300 / $57.07 |
Paid |
Mar 30,2023 14:07:55 |
Ja*** |
$200 / $37.71 |
Paid |
Apr 03,2023 18:11:00 |
ga*** |
$150 / $29.65 |
Paid |
Mar 28,2023 10:36:29 |
va*** |
$150 / $27.22 |
Paid |
Mar 30,2023 14:03:42 |
Bo*** |
$150 / $28.32 |
Paid |
Mar 28,2023 05:21:08 |
pa*** |
$150 / $27.22 |
Paid |
Mar 31,2023 12:14:17 |
ro*** |
$130 / $26.22 |
Paid |
Apr 01,2023 01:35:57 |
Ta*** |
$120 / $28.89 |
Paid |
InvesTracing
RCB
|
$1,467.00
$325.75
|
22 deposits
min: $20
max: $200
avg: $67
|
 |
Top 10 Deposits |
Users with multiple deposits: 0 |
Time |
User |
Deposit / RCB |
Status |
Apr 02,2023 23:31:06 |
li*** |
$200 / $40.04 |
paid |
Mar 29,2023 11:42:50 |
ti*** |
$100 / $20.42 |
paid |
Mar 26,2023 21:30:34 |
mo*** |
$100 / $20.01 |
paid |
Apr 03,2023 01:23:32 |
ke*** |
$100 / $23.84 |
paid |
Apr 02,2023 17:37:04 |
ze*** |
$100 / $27.42 |
paid |
Apr 05,2023 11:42:10 |
Ra*** |
$100 / $24.42 |
paid |
Mar 26,2023 15:47:30 |
10*** |
$100 / $20.01 |
paid |
Apr 03,2023 00:14:23 |
go*** |
$79 / $16.09 |
paid |
Mar 26,2023 14:21:04 |
je*** |
$77 / $15.36 |
paid |
Mar 26,2023 16:45:57 |
im*** |
$70 / $13.32 |
paid |
|
Here's what it says on the transorous.com website:
TRANSOROUS is a leading financial
technology company that offers innovative investment solutions. Our team
of experts has extensive experience in the financial industry and is
committed to transforming the way people invest and grow their wealth.
Our mission is to provide investors with a reliable and easy-to-use
platform to optimize investment performance and minimize risk. With a
focus on transparency, accessibility, and flexibility, we aim to create a
more accessible and efficient investment landscape for everyone. We
believe that by combining our expertise with the power of Knowledge, we
can help investors achieve their financial goals and unlock their full
potential.
To
register with transorous.com, simply go to the website, click "Sign Up"
and fill out the required information. Once you have completed these
steps, you will be able to access your account and start investing.
Additionally, it is recommended that you use a secure password for each
account and enable two-factor authentication for added security. Gmail
is a popular email service provider and can be used for registration
To choose
a Lucky Investment Package on transorous.com, you will first need to
log in to your account and top up your account balance via the Add Funds
option. Once your account balance has been updated, you can select the
investment plan of your choice. You will be presented with a list of
available plans, which can include 12 Hours and 24 Hours plans. Once
your purchase is confirmed, you have to wait for the results within
12-24 hours.
transorous.com accepts a variety of payment methods for deposits and
withdrawals, including Bitcoin, Litecoin, Ethereum, Dash, Ripple,
bitcoinCash, Dogecoin, Tether, Tron, Stellar, Tether TRC20, Tether
BEP20, BNB. Depending on the payment method you select, you may be
subject to fees and other restrictions. the fee will be paid to the
wallet provider.
During this time, you will not be able to access your funds. If your
deposit was on the third turn deposit on the system deposit list, it
means you won. After the 12-24 hour period is over, you will be able to
access your rewards and use them for your next deposit or to withdraw.
It is
important to note that the rewards are only valid for each next third
turn deposit, and if your turn win, won amount will be be valid for any
other type of deposit or withdrawal.
It is important to
remember that luck can play a part in your success or failure, but it is
also important to remember that to check your chance are often even
more important. If you feel that you have lost, don't give up. Try again
buy Lucky Package and you may win your reward.
If you
don't want to invest, you can share your referral link to earn referral
commissions from deposits made by your referrals. transorous.com offers 4
levels of referral commissions: first level 7%, second level 3%, third
level 2%, fourth level 1%, You can share your referral link with anyone
you choose, and you'll earn referral commissions for every successful
deposit made by your referrals.
Referral Commission. Invite Friends & Get Free Bitcoin. Join one of the best cryptocurrency affiliate
programs and earn with minimum effort overall, Binance offers excellent
commission fees for its affiliates.
You can earn money by
referring individuals to our system through our referral program. With
our help, you can form the greatest team possible. We have a three-level
referral program with commissions of 5%, 3%, 2% and 1%. Try to persuade
as many individuals as you can; each new person means more money for
you. Share your referral link to friends and family, and post it on
social media. We will offer you with the essential information and
promotional materials.
To make a investment you must first become a member of Transorous. Once
you are signed up, you can make your first deposit. All deposits must be made
through the Members Area. You can login using the member username and password
you receive when signup.
To make a investment you must first become a member of Transorous. Once
you are signed up, you can make your first deposit. All deposits must be made
through the Members Area. You can login using the member username and password
you receive when signup.
To make a spend you must first become a member of Transorous. Once you
are signed up, you can make your first spend. All spends must be made through
the Member Area. You can login using the member username and password you received
when signup.
Yes! To make a deposit from your Transorous account balance. Simply login
into your members account and click on Make Deposit ans select the Deposit from
Account Balance Radio button.
There is a risk involved with investing in all high yield investment programs. However,
there are a few simple ways that can help you to reduce the risk of losing more than
you can afford to. First, align your investments with your financial goals,
in other words, keep the money you may need for the short-term out of more aggressive
investments, reserving those investment funds for the money you intend to raise
over the long-term. It's very important for you to know that we are real traders
and that we invest members' funds on major investments. binance offers excellent commission feespopular email service providerleading financial technology companyoffers innovative investment solutionshigh yield investment programsaccount balance radio buttonll earn referral commissionsmake deposit ans selectcryptocurrency affiliate programsefficient investment landscapeoptimize investment performancebuy lucky packageinvite friends &lucky investment packageadd funds optionminimum withdrawal limitearn referral commissionslifetime referral rewardslevel referral programsuccessful deposit madereferral commissiontransorous account balancesystem deposit listoffers 4 levelslucky packagereferral commissions:wallet providerreferral programaffiliate programaccount balanceinvestment planreferral linkminimum effortll rewardfinancial industryfinancial goalsinvestment fundsincluding bitcoinpayment methodpayment methodssupported assetsmembers areamembers accountsimple waysreal traderspromotional materialsessential informationfree bitcoinfactor authenticationsocial mediaremain secure4 hour periodfull potentialextensive experienceprovide investorsinvestors achieverequired informationturn depositdirect depositearn moneyminimize risktether beppeople investaggressive investmentstether trcmajor investmentsinvest membersrisk involvedfourth levelmember usernamemember areastart investingperson meansadded securitywon amountturn winreferring individualsgreatest teamsecure passwordfeesdeposits made4 hours planssimply logininvestmentearncommissionswithdrawalfriendslistselectsystemaccountdepositriskinvestmentsinvesttethermadefundslevel 7%levelmembermeansindividualswonteamrewardinvestingwinsimplyplansrewardsaddedmakehourslogin4 hoursmoneypassworddepositstransorous
|
Host : |
transorous.com |
Registrar : |
NameSilo, LLC |
|
Nameservers : |
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)
|
|
Created : | 2023-01-26 |
---|
Expires : | 2024-01-26 |
---|
Updated : | 2023-03-14 |
---|
|
|
Latest Events
|
|
 |
Pay-Clock
Tradinghyips 2 hours ago
added |
paying
|
|
 |
Pay-Clock
Ishprash 4 hours ago
added |
paying
|
|
 |
|
|
 |
Synox Mining
Instantmonitor 10 hours ago
changed |
problem »
not paid
|
|
 |
|
|
 |
|
|
 |
|
|
|