This «RiskRank» metric is a general litmus test for the quality of the «Tradechest.net» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of tradechest.net and the results from 0 to 10 points.
tradechest.net good quality signs:
High-quality hosting ensures constant access, reliability, performance and security;
Has a licenced GoldCoders script;
Featured on a reputable HYIP monitoring platforms;
tradechest.net red flags:
Free SSL without a confidence guarantee;
Some texts similarities to other HYIPs;
IP 45.58.136.4 that occurs elsewhere for 5 HYIP;
0.0
This project is a scam and stops paying on Nov 17, 2020.
Warning! The "tradechest.net" project is marked as "Blacklist/SCAM" on the following URL(s):
Here's what it says on the tradechest.net website:
Our Packages
Open An Account
We first use our traders’ experience and knowledge to establish a
link between the price of individual digital coins and the
cryptocurrency market. Using the econometrics and statistical methods,
we look at the precision and, with the help of data mining, we enhance
the predictive parts for the next step.
Share your referral link, which is made available in your account,
with friends, and you’ll earn 4% from their active deposit. You can even
earn 8% when you apply for a Representative status with our company.
world famous exchangesour companyindividual digital coinsannouncements telegram announcementwillturkish language supporttelegram announcement channeldistributed winner receives $dedicated support teamtelegram channelyoutube channelcompany offersreferral activitybroadcast simultaneouslyearned referencedata miningpredictive partsrepresentative statusstatistical methodscryptocurrency marketwin 5 tradescompany growscryptocurrency tradingreference rankingprecious metalpeople aimingsafe profitll earn 4%earn moneyevent resultscontact pagereferral link7 forex tradesshared regularlytraders&rsquoactive deposittelegram4/7 supportchannelcompanyteamearnreceiveslinkreceives 5eventpage&rsquoforexshareddeposit
Domain Information
#Whois
Host :
tradechest.net
Registrar :
NameCheap, Inc.
Nameservers :
cloud1.lotusproxy.com (185.136.96.77)
cloud2.lotusproxy.com (185.136.97.77)
cloud3.lotusproxy.com (185.136.98.77)
cloud4.lotusproxy.com ((DOES NOT EXIST))
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here.
Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
575 views [10 clicks]
Domain:
Script: GoldCoders - Licensed
Dedicated server
- 1 domain hosted on IP: 45.58.136.4
Found similar content
[text: 
