Check out HYIPs with HYIP.biz
Reviews+37 | Payouts+50 |  Blacklist+3 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 23 Apr 2024 19:26:44
Last Update: 23 Apr 2024 19:00:03
 
Join with: 
 
Hedgers
0.0
Hedgers
+
Added: Apr 30,2021 10:55
Closed: May 12,2021 [12 days]
Our Investment: $100
Payment systems:
Features:
ddos protection
Not Paid
Plans: 20% hourly forever, 50% hourly for 10 hours, 1500%
Min deposit: $1
Max deposit: $100000
Referral: 7%-2%-1%
Withdrawal: Instant
524 views [52 clicks] Reviews: 000
HYIPexplorer note: Don't invest here! All payout plans are not viable.
Warning! The "hedgers.biz" project is marked as "Blacklist/SCAM" on the following URL(s):
https://www.hyipnews.com/hyip-monitor/blacklist/
Domain: hedgers.biz is registered for a 1 year by NameCheap, Inc.
[from Apr 19,2021 to Apr 19,2022]
~
ssl SSL valid for a 11 months - Cloudflare, Inc.
+
Licensed Script: GoldCoders - Licensed
+
Shared Hosting  Cheap price hosting - 190 domains hosted on IP: 172.67.181.179
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] -
IP: 172.67.181.179 [not used in other projects]
Network: 172.64.x.x [1492 projects] United States
+
Found similar content [design: 14 projects] [text: 240 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "hedgers.biz"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ HYIPexplorer 57
not paid
12 Jul 2021
$200 72%
144 USD
10 May 2021
2 years ago
problem » not paid
2 years ago
30 Apr 2021
2 years ago
+ SQMonitor 14
not paid
12 May 2021
$200 36%
72 USD
09 May 2021
2 years ago
paying » not paid
2 years ago
30 Apr 2021
2 years ago

Content
#Tags

Here's what it says on the hedgers.biz website:

In the first phase of our investment process we collect data from a variety of traditional and alternative sources. In order to maximize our chances of finding new sources of alpha, we consider multiple datasets, including financial, fundamental, macroeconomic, government, and alternative sources. This allows us to develop a deeper understanding of how financial markets work by testing our hypotheses in a more comprehensive and extensive way in the following phases of our strategy development framework. We use proprietary automated algorithms to clean the vast amounts of data at our disposal. Thereafter, our data scientists review and check the automated cleaning procedures to make sure that the data sets are clean and can be used thereafter by our quantitative researchers. Then we analyze the data sets processed in the previous step using sophisticated and advanced statistical methods in order to find alpha signals. Having confirmed that pilot trading returns are consistent with the backtest and what we expected, our investment team allows our clients to invest in the new investment product.
Hedgersfully systematic quantitative global macro investment program coveringsophisticated proprietary quantitative research processunwanted cryptocurrency price risklarge crypto holdings exposerobust risk management frameworksophisticated risk management frameworksignificant crypto price riskaverage annualized volatility levelmultiple quantitative investment strategiesproprietary automated algorithmsaverage annualized volatilitydeliver superior riskstrategy development frameworkautomated cleaning proceduresico companies raisedpilot trading returnsadvanced statistical methodsminimize technological issuesdata scientists revieweasily make modificationspotentially selling cryptocurrenciesdata sets processedfinancial markets worktraditional asset classesfind alpha signalsinvestment managementquantitative developersquantitative researchersinvestment processinvestment strategycrypto minersmultiple datasetsfind signalsvalidation processstrategies undergoasset classesinvestment portfoliosinvestment productsolid investmentsuperior technologicalsignificant contributiondata setssignificant amountwork hardequity marketsadvanced degreesadjusted returnsvolatility comparedinvestment teamhistorical datacollect dataoffering competitiveconstantly improveelectricity costspotential inabilityinnovative productsmembers joindeeper understandingoperational infrastructurevast amountshuman talentincluding financialprevious stepsubstantial amountprimary importanceprimary factorpredefined limitsextreme levelstechnological fieldsrecurring expensesalternative sourcesscientific methodoperating expensesrisks embeddedfinal objectivefixed incomeextensive backtestingmain objectiveinvested capitalhuman capitalsophisticatedlive productioncompany residesvolatilitydatatraditionalexpensesalphamakescientificcryptocurrenciessourcesobjectiveextensivefixedincludingteamrisksfieldscapitalproductioncompany

Domain Information
#Whois
Host : hedgers.biz
Registrar : NameCheap, Inc.

Nameservers :
rosemary.ns.cloudflare.com (108.162.194.77)
patryk.ns.cloudflare.com (108.162.195.122)

Created :2021-04-19
Expires :2022-04-19
Updated :2021-04-24

Monitoring
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Bitmote Limited
2 hours ago
1.2
New HYIP Hitbit
7 hours ago
0.2
New HYIP Speed-Gain
8 hours ago
0.1
New HYIP Gtpcd
9 hours ago
1.0
New HYIP Randolimit
10 hours ago
0.8
New HYIP Best-Gold
1 day ago
0.1
New HYIP Bit Sweep
1 day ago
2.1
Latest Events
Recent event
Speed-Gain
Bakster 1 hour ago
added | paying
Recent event
Bitmote Limited
Hothyips 2 hours ago
added | waiting
Recent event
Xullex.com
Investracing 5 hours ago
changed | waiting » paying
Recent event
Randolimit
Investracing 5 hours ago
changed | waiting » paying
Recent event
Smart Trading Hub
Sqmonitor 7 hours ago
changed | paying » problem
Recent event
Hitbit
Sqmonitor 7 hours ago
added | paying
Recent event
Speed-Gain
Ishprash 8 hours ago
added | paying
Problematic HYIP & Scam
Smart Trading Hub
Closed: 7 hours ago
Pay Genting Ltc
Closed: 11 hours ago
Gold-Hour
Closed: 14 hours ago
Legalpay
Closed: 1 day ago
Arbitain
Closed: 1 day ago
Metago.bot
Closed: 1 day ago
Vixess Ltd
Closed: 1 day ago
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback