Server Time: 15 Mar 2026 17:19:59
Last Update: 15 Mar 2026 17:00:02
Telegram
 
Join with: 
Hedgers
Reviews: 000
[903 views]
[110 clicks]
Hedgers
Added: Apr 30,2021 10:55
Closed: May 12,2021 [12 days]
Our Investment: $100
Not Paid
Payment systems:
Features:
SSLDDOS protection
Plans: 20% hourly forever, 50% hourly for 10 hours, 1500%
Min deposit: $1 Max deposit: $100000
Referral: 7%-2%-1%
Withdrawal: Instant
X
This project is a scam and stopped paying on May 12, 2021.

«Hedgers» [hedgers.biz] Summary

The «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Hedgers», evaluated based on multiple criteria. Below is a detailed analysis of hedgers.biz, with a score ranging from 0 to 10 points.

Green flags:

  • The website uses Cloudflare, Inc. SSL encryption. All of the incoming and outdoing content is encrypted;
  • IP address not used by other HYIPs;
  • Has a licenced GoldCoders script;
  • Featured on a reputable monitoring platforms;

Red flags:

  • Shared hosting: Multiple websites on this IP could impact speed and reliability, depending on server optimization;
  • Plagiarized design elements from other HYIPs;
HYIPexplorer note: Don't invest here! All payout plans are not viable.
Warning! The "hedgers.biz" project is marked as "Blacklist/SCAM" on the following URL(s):
https://www.hyipnews.com/hyip-monitor/blacklist/
Domain: hedgers.biz is registered for a 1 year by NameCheap, Inc.
[from Apr 19,2021 to Apr 19,2022]
~
ssl SSL valid for a 11 months - Cloudflare, Inc.
+
Licensed Script: GoldCoders - Licensed
+
Shared Hosting  Server - IP address 172.67.181.179 hosts 190 domains
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] -
IP: 172.67.181.179 [not used in other projects]
Network: 172.64.x.x [1812 projects] United States
+
Found similar content [design: 14 projects] [text: 240 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "hedgers.biz"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ HYIPexplorer 57
not paid
12 Jul 2021
$200 72%
144 USD
10 May 2021
4 years ago
problem » not paid
4 years ago
30 Apr 2021
4 years ago
+ SQMonitor 14
not paid
12 May 2021
$200 36%
72 USD
09 May 2021
4 years ago
paying » not paid
4 years ago
30 Apr 2021
4 years ago

Content
#Tags

Here's what it says on the hedgers.biz website:

In the first phase of our investment process we collect data from a variety of traditional and alternative sources. In order to maximize our chances of finding new sources of alpha, we consider multiple datasets, including financial, fundamental, macroeconomic, government, and alternative sources. This allows us to develop a deeper understanding of how financial markets work by testing our hypotheses in a more comprehensive and extensive way in the following phases of our strategy development framework. We use proprietary automated algorithms to clean the vast amounts of data at our disposal. Thereafter, our data scientists review and check the automated cleaning procedures to make sure that the data sets are clean and can be used thereafter by our quantitative researchers. Then we analyze the data sets processed in the previous step using sophisticated and advanced statistical methods in order to find alpha signals. Having confirmed that pilot trading returns are consistent with the backtest and what we expected, our investment team allows our clients to invest in the new investment product.
Hedgersfully systematic quantitative global macro investment program coveringsophisticated proprietary quantitative research processunwanted cryptocurrency price risklarge crypto holdings exposerobust risk management frameworksophisticated risk management frameworksignificant crypto price riskaverage annualized volatility levelmultiple quantitative investment strategiesproprietary automated algorithmsaverage annualized volatilitydeliver superior riskstrategy development frameworkautomated cleaning proceduresico companies raisedpilot trading returnsadvanced statistical methodsminimize technological issuesdata scientists revieweasily make modificationspotentially selling cryptocurrenciesdata sets processedfinancial markets worktraditional asset classesfind alpha signalsinvestment managementquantitative developersquantitative researchersinvestment processinvestment strategycrypto minersmultiple datasetsfind signalsvalidation processstrategies undergoasset classesinvestment portfoliosinvestment productsolid investmentsuperior technologicalsignificant contributiondata setssignificant amountwork hardequity marketsadvanced degreesadjusted returnsvolatility comparedinvestment teamhistorical datacollect dataoffering competitiveconstantly improveelectricity costspotential inabilityinnovative productsmembers joindeeper understandingoperational infrastructurevast amountshuman talentincluding financialprevious stepsubstantial amountprimary importanceprimary factorpredefined limitsextreme levelstechnological fieldsrecurring expensesalternative sourcesscientific methodoperating expensesrisks embeddedfinal objectivefixed incomeextensive backtestingmain objectiveinvested capitalhuman capitalsophisticatedlive productioncompany residesvolatilitydatatraditionalexpensesalphamakescientificcryptocurrenciessourcesobjectiveextensivefixedincludingteamrisksfieldscapitalproductioncompany

Domain Information
#Whois
Host : hedgers.biz
Registrar : NameCheap, Inc.

Nameservers :
rosemary.ns.cloudflare.com (108.162.194.77)
patryk.ns.cloudflare.com (108.162.195.122)

Created :2021-04-19
Expires :2022-04-19
Updated :2021-04-24

Monitoring
New HYIP Lajaprofit
Invested: $200
paying
New HYIP King Hectares
Invested: $150
paying
New HYIP Cryptxtrade.org
Invested: $150
paying
New HYIPs
New HYIP Winvest
1 day ago
7.2
New HYIP Morela
11 Mar 2026
1.7
New HYIP Fast Burger
11 Mar 2026
0.0
New HYIP Elementex
09 Mar 2026
4.8
New HYIP Odoo
07 Mar 2026
2.1
New HYIP Ryzex
07 Mar 2026
1.8
New HYIP Mevprimebot
05 Mar 2026
3.4
Latest Events
Recent event
Foxvanta
Investracing 3 hours ago
changed | waiting » paying
Recent event
Winvest
Hyipexplorer 4 hours ago
added | waiting
Recent event
Zenthex
Sqmonitor 12 hours ago
removed | problem
Recent event
Fast Burger
Sqmonitor 12 hours ago
removed | paying
Recent event
Winvest
Sqmonitor 23 hours ago
added | paying
Recent event
Winvest
Richinvestmonitor 1 day ago
changed | waiting » paying
Recent event
Foxvanta
Investracing 1 day ago
added | waiting
Problematic HYIP & Scam
Fast Burger
Closed: 12 hours ago
Invest Dex Limited
Closed: 13 Mar 2026
Zenthex
Closed: 12 Mar 2026
Hyperfund
Closed: 12 Mar 2026
Bluenova
Closed: 12 Mar 2026
Tron Ninja
Closed: 11 Mar 2026
Impmoney
Closed: 10 Mar 2026
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback