Check out HYIPs with HYIP.biz
Reviews+4 | Payouts+26 |  Blacklist+2 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 25 Apr 2025 10:50:14
Last Update: 25 Apr 2025 10:00:02
 
Join with: 
 
Globalfin
0.0
Globalfin
+
Added: Dec 20,2020 20:55
Closed: Jan 14,2021 [25 days]
Payment systems:
Features:
ddos protection
Not Paying1
Plans: 1-2% weekly 180 days
0.3-0.5% daily 365 days
Min deposit: $1
Max deposit: $∞
Referral: 5% - 2% - 1%
Withdrawal: Instant
406 views [1 click] Reviews: 000

«Globalfin» summary

This «RiskRank» metric is a general litmus test for the quality of the «Globalfin» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of globalfin.io and the results from 0 to 10 points.

globalfin.io good quality signs:

  • The domain globalfin.io is registered for two years, which is a good thing;
  • High-quality hosting ensures constant access, reliability, performance and security;
  • IP address not used by other HYIPs;

globalfin.io red flags:

  • Free SSL without a confidence guarantee;
  • Plagiarized design elements from other HYIPs;
  • Some texts similarities to other HYIPs;
  • Not featured on reputable HYIP monitoring platforms;
  • The website globalfin.io uses a not licenced script;
0.0
This project is a scam and stops paying on Jan 14, 2021.
Domain: globalfin.io is registered for a 2 years by Gandi SAS
[from Feb 11,2020 to Feb 11,2021]
+
ssl Free SSL valid for a 3 months - Let's Encrypt
-
Not Licensed Script: GoldCoders - Not Licensed
-
Dedicated Server  Dedicated server - 1 domain hosted on IP: 54.252.131.176
+
Hosting: Amazon.com, Inc. [ amazonaws.com ] +
IP: 54.252.131.176 [not used in other projects]
Australia
+
Found similar content [design: 1 project] [text: 28 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "globalfin.io"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ HotHYIPs 80
not paid
15 Jan 2021
$20 -
-
waiting » not paid
4 years ago
20 Dec 2020
4 years ago

Content
#Tags

Here's what it says on the globalfin.io website:

We are an excellent organisation with experienced financial planners. We guarantee to clinch off our client’s requirements through our indubitable service. Our main motive weighs more to lead you to a luminous future and escort you to achieve your intended business objectives, by providing requisite financial services. You can feel our breezing benefits , whereas you’ll not be forced to follow exhausting policies. Everyone stresses over the future especially where finances are concerned. You can now remove a large portion of worry from your life by planning for your future now. globalfin.io is focused on helping you reach your goals of financial freedom so that you can live your life comfortably. We have several years of planning business development and financial services which sets us apart from the rest and makes us the best company to assist you in your project. We are specialist in issuing several kinds of bank instruments to help business organizations to achieve their expected objectives in time. Our instruments vary from Bank Guarantee, Medium Term Notes, Standby Letter of Credit, Proof of Fund, Monetization. We offer Leasing and Selling of Financial Instruments at affordable rate with reason terms and condition. Currently, many businesses find difficult to keep a step further as they assume it to be risky and uncertain. However, we have designed our financial planning to give the most accurate and efficient results in a low risky manner We have a long-term experience in assisting thousands of clients from various background, so we assure to quench your business thirst by our resources and services. When globalfin.io was founded, we could see that businesses weren’t being given the finance to grow, while investors were making poor returns. By lending directly to businesses through globalfin.io, investors can now earn attractive returns to better provide for their future. Businesses get fast, easy access to funding to grow, create jobs, support local communities and drive the economy forward. We believe it’s better for everyone. Business owners and investors share a common thread. They’re forward thinkers. They’re determined. They stand up to make a difference and work hard to make it happen. That same thread runs through everyone at globalfin.io. It’s a shared mission that inspires us – we help you as you change the world. So whether you’re a business owner who aspires to more, or an investor who wants your money to go further, we believe in you. You’re the ones we built globalfin.io for. Before we touch a project we do a further evaluation to analysis the level of success or failure. If we determine an organization is going to experience a good future then we’ll recognize it as our source of funding. But if the level of success is far or unachievable we’ll find further actions to resolve it. We cannot assure that all projects can be handled easily as it may need additional innovative ideas to finish off. This situation can be hard for you as well as it can be a challenging task to us. However in such situation our closes partners would join us to make your financial plans clear and efficient. globalfin.io is one of the best-capitalised lending platforms in the world. We have raised approximately €10 Billion worth of Financial Instruments and project Funds since 2018 from some of the largest and most sophisticated investors and Banks around the world. Coin mining by traditional electric energy is difficult because of many problems. First is the power supply. Based on data collected from Eurostat, electricity price has increased by more than 10% in the last decade. So organizations and individuals who mine cryptocurrencies have been trying to reduce costs. Currently in the context of market conditions is no longer peaking as late of 2017, this has become more important than ever. Current mining cryptocurrencies using solar energy by installing solar panels to operate mining machines can reduce 30 ~ 75% of the cost of mining. Solar energy is giving hopes for small and medium bitcoin mining companies to face with the up and down conditions of the world cryptocurrency market. In recent studies of the use of renewable energy to mine bitcoins, they show that we can recover about 72% of the heat generated. Using alternative methods such as mini hydro, wind power, solar energy is cheap and easy to exploit but with a high initial investment. The new initiative is financed on the balance sheet (corporate financing) The new project is incorporated into a newly created economic entity, the SPV, and financed off-balance sheet (project financing) #1 Corporate Finance Alternative 1 means that the sponsors use all the assets and cash flows from the existing firm to guarantee additional credit provided by lenders. If the project is not successful, then all the remaining assets and cash flows can serve as a source of repayment for all the creditors (old and new) of the combined entity (existing firm plus new project). #2 Project Finance Alternative 2 means instead that the new project and the existing firm live two separate lives. If the project is not successful, project creditors have no (or very limited) claim on the sponsoring firm’s assets and cash flows. The existing shareholders then benefit from the separate incorporation of the new project into an SPV. The table below outlines important differences between the two types of financing that need to be taken into account. #1 Financing of long-term infrastructure, industrial projects, and public services Project finance is generally used in oil extraction, power production, and infrastructure sectors. These are the most appropriate sectors for developing this structured financing technique, as they have low technological risk, a reasonably predictable market, and the possibility of selling to a single buyer or a few large buyers based on multi-year contracts (e.g. take-or-pay contracts). #2 Non-recourse/limited recourse financial structure Project finance is the structured financing of a specific economic entity – a Special Purpose Vehicle (SPV) – created by the sponsors using equity or debt. The lender considers the cash flow generated from this entity as the major source of loan reimbursement. Hence, if the borrower has a debt default, the debt-issuer has the right to seize the assets of the said SPV. However, they do not have the right to any further assets that are not part of the SPV, even if the liquidating assets of the SPV are not sufficient to cover the value owed due to default. #3 Payment from cash flow generated by the project Cash flows generated by the SPV must be sufficient to cover payments for operating costs and to service the debt in terms of capital repayment and interest. Because the priority use of cash flow is to fund operating costs and to service the debt, only residual funds after the latter are covered can be used to pay dividends to sponsors undertaking the project. In brief, four types of sponsors are very often involved in such transactions: Industrial sponsors – They see the initiative as upstream and downstream integrated or in some way as linked to their core business Public sponsors – Central or local government, municipalities, and municipalized companies whose aims center on social welfare Contractor sponsors – Who develop, build, or run plants and are interested in participating in the initiative by providing equity and or subordinated debt Financial sponsors/investors – Invest with a motive to invest capital in high-profit deals. They have a high propensity for risk and seek a substantial return on investments globalfin.io is a company operating in the field of direct manufacturing and making profit through mining with solar energy to create profits for the company and pay stable capitals and interests for investors. No, you are not allowed to own more than one account. Please duly note that only one account is allowed per person. We have security settings that help us to prevent fraud and similar kind of situations. For security reasons, we do not allow users to change their e-mail after registration. If you would like to change your e-mail, please contact our support and we will change it for you. No, recommending yourself is deemed as a kind of cheating and extremely forbidden in our referral program. You will not get any commission or bonus by recommending yourself. Besides, we may suspend your accounts. Once you understand your capital needs, and whether or not you have the internal cash flow to meet all those needs, it could make sense to consider borrowing to cover any short-term gap. For example, retailers might borrow to fund seasonal inventory build up or businesses like landscape contractors might borrow to bridge from one season to the next. However, if you don’t have the cash flow to make the periodic payments for a short-term loan, it may not be the right approach—particularly if it throws your ratio into negative territory. Businesses that traditionally have seasonality in their capital requirements can (and should) plan ahead to anticipate those needs. In addition to your Accounts Receivable, there are several sources of capital to finance your working capital needs: Trade Credit: If you are on good credit terms and have a good relationship with your vendors and suppliers, it’s possible to negotiate payment terms to accommodate the seasonality of your business. Suppliers are often amenable to working with their best customers when they need to fund a large order to ramp up a new contract or bridge a short-term need for additional capital by extending payment terms. Of course, you’ll likely have greater success negotiating with a supplier if you’re currently on good payment terms with them. Factoring: This is a popular way to free up funds within the textile business because the manufacturing process can be long and the payment cycle might not be very quick. Basically, you’re selling your Accounts Receivable at a discount to have access to the capital now, rather than wait for the manufacturing and payment process. If you offer your regular customers payment terms and invoice for your goods or services, factoring could be a financing option for you. A Line of Credit: Lines of credit can be more difficult to qualify for than a short-term small business loan, but for those that qualify they offer the ability to access a credit line when you need it, pay interest on the amount of credit you use, pay off the balance, and use it again. Lines of credit are available from both traditional lenders like a bank or credit union, as well as online lenders like globalfin.io. A Short-Term Small Business Loan: A short-term business loan (think in terms of three to 12 months) could be a good option for financing a small business’ cash flow needs. Depending on your credit profile, the industry you’re in, and the overall health of your business, you could have more than one option available to your business—including a short-term small business loan. Published on Dec 13,2020 The definition of working capital your accountant would likely share with you is: Working Capital = Current Assets – Current Liabilities. It’s not enough to simply have cash in the bank at the end of the month. Your current assets are made up of cash in the bank, your current Accounts Receivable, and your inventory. Your liabilities are defined as your current Accounts Payable and any long-term payables (think small business loans, lines of credit, etc.) your business may have. If you divide the value of your current liabilities into your current assets, you’ll come up with a ratio of assets to liabilities—the goal should be to shoot for twice as many assets as you have liabilities (or a 2:1 Ratio). Anything below a 1:1 ratio is a giant red flag that you have negative working capital—even if you have cash in the bank at the end of the month. In terms of small businesses, it might make more sense to consider the formula in terms of the average number of days it takes your inventory to turn over, how quickly you need to pay for that inventory, and the average number of days it takes for your customers to pay you. If you’re customers don’t pay you quickly enough to meet your financial obligations to your suppliers (or your inventory sits on the shelf too long—tying up capital that could otherwise be used to increase revenue and profits), you will have trouble meeting your capital needs out of cash flow. In other words, staying on top of your average inventory turns is just as important as monitoring your Accounts Payable and Accounts Receivable to maintain a ratio of 1:1 or better—with the goal of 2:1. It’s not uncommon for businesses to struggle fueling their capital needs with Accounts Payable alone. Many businesses turn to financing to bridge the gap using a combination of net profits and borrowed funds to meet the shortfall. Nevertheless, any financing you use for this becomes a liability and needs to be included in your ratio, so if you’re not careful, you could negatively impact that metric by borrowing and make your business unprofitable. This may sound like a bunch of accounting mumbo-jumbo, but this is a very important ratio to understand. And, it’s fair to say that most businesses never attain the 2:1 ratio (but then again, roughly half of all the businesses that start today will be out of business within five years). Supporting evidence of the importance of this metric. Published on Dec 12,2020 Working capital finance is business finance designed to boost the working capital available to a business. It's often used for specific growth projects, such as taking on a bigger contract or investing in a new market. Different businesses use working capital finance for a variety of purposes, but the general idea is that using working capital finance frees up cash for growing the business which will be recouped in the short- to medium-term. There are many different types of lending that could be considered working capital finance. Some are explicitly designed to help working capital (whatever industry you’re in), while others are useful for specific sectors or requirements. It’s commonly defined as current assets minus current liabilities. Usually working capital is calculated based on cash, assets that can quickly be converted to cash (such as invoices from debtors), and expenses that will be due within a year. Liquid cashWorking capital is seen as ‘working’ because the business can use it — in other words, it’s not tied up in anything long-term. Whether you want to buy stock, invest in the business, or take on a big contract, all of these activities require working capital — cash that’s quickly accessible. On the other hand, if your business is profitable but has big bills to pay soon, your working capital situation could be worse than it might seem — or could even be negative. This is a business’ current assets divided by its current liabilities. It informs investors and others as to whether the company has the current means to meet its short-term obligations.2 and 2.0 is considered satisfactory. A working capital ratio of below 1 suggests potential cash problems. For instance, a very high working capital ratio could indicate that a business isn’t investing its surplus capital into its growth, but is instead missing opportunities by letting its cash and assets lay dormant. A business’ working capital can fluctuate - for instance, it may experience seasonal peaks and dips. Take a retail business for instance. It may need a lot of available cash to purchase inventory. A tech company, on the other hand, might not - especially if it operates remotely. There are many types of working capital financing available, and choosing the right product depends on your sector and circumstances, as well as what you're trying to achieve. To find out more about working capital financing, browse the related articles below or get in touch. Published on Dec 10,2020 Blockchain app marketplaces are attracting attention from major investment companies. An increasing number of blockchain app marketplaces, which gather blockchain-based decentralized applications (dapps) to help users download them at one sitting and provide usage data, are attracting funding from major investment companies. Considering the fact that mobile apps enjoyed a boom following the emergence of Apple’s App Store and Google Play Store, investors’ growing interest in dapp marketplaces is seen as a sign of a large-scale expansion of blockchain-based apps. globalfin.io and DappRadar, which provide information about dapps, are expanding their business after attracting investment from major investment firms, according to related industry sources on Sept. 16. In particular, they are expanding their business in the domestic market and increasing the number of users. globalfin.19 billion won) in globalfin.io with Singapore’s crypto fund Du Capital. globalfin.io is an app marketplace which distributes dapps that run on various blockchain platforms including Etherleum and EOS. Using unique algorithms, it offers dapp ranking services and releases a quarterly market analysis report. Hashed CEO Kim Seo-joon said, “Unlike traditional app stores, the blockchain app ecosystem needs a new marketplace which creates value through minimum platform fees, onchain-based objective data analysis, a fair ranking system and participation by the community. We have decided to take part in rapidly growing globalfin.io as a strategic investor.” DappRadar has a similar business model with globalfin.io.30 million (2.73 billion won) in investment from several investors, including Naspers Ventures located in South Africa. Naspers Ventures is a venture capital arm of Naspers, the largest shareholder of China’s global information and technology firm Tencent. In addition to Naspers Ventures, Blockchain.com Ventures and Angel Invest Berlin invested in DappRadar. DappRadar is a platform designed to monitor and analyze decentralized app data. It tracks around 2,500 dapp projects on seven blockchain platforms, including Ethereum, EOS, and TRON. The company aims to become the most sought out distribution channel when users look for dapps. With globalfin.io and DappRadar leading the dapp market, there is no such company in the sector in South Korea. Only Kakao is preparing for a service that distributes Klayton platform-based blockchain apps through its cryptocurrency wallet service “Klip” to be launched by the end of the fourth quarter. Published on Dec 07,2020.
Globalfinrecourse/limited recourse financial structure project financesocial welfare contractor sponsors &ndashglobal leading blockchain investment firm hashedsubordinated debt financial sponsors/investors &ndashcore business public sponsors &ndashhashed ceo kim seoactivities require working capital &mdashcurrent assets minus current liabilities: working capital = current assets &ndashunlike traditional app storestransactions: industrial sponsors &ndashanalyze decentralized app dataspecific economic entity &ndashquarterly market analysis reportnewly created economic entitycrypto fund du capitalangel invest berlin investedproviding requisite financial servicesoffers dapp ranking servicesvat bill worth £blockchain platforms including etherleumpublic services project financeworking capital finance freessuggests potential cash problemsworking capital efficiency calculatedbased objective data analysiscryptocurrency wallet service &ldquomedium bitcoin mining companiesconsidered working capital financeincluding naspers ventures locatedguarantee additional credit providedregular customers payment termsfund seasonal inventory buildterm small business loan:term small business loannegative working capital&mdashproject cash flows generatedhigh working capital ratioexperienced financial plannerstechnology firm tencentbased decentralized applicationsfollow exhausting policiesearn attractive returnsspecial purpose vehiclebackers collectively manageadditional innovative ideasgiant red flagraised approximately &euroworking capital efficiencyblockchain app ecosystemfinancial plans clearminimum platform feesmobile apps enjoyedventure capital armliquid cashworking capitalmaking poor returnsfair ranking systemgoogle play storeexperience seasonal peaksblockchain app marketplacesworking capital financelow working capitalcontrol working capitaloperate mining machinesprovide usage dataproject finance ventureinstalling solar panelsdistributes klayton platformtraditional electric energymanage inventory effectivelymajor investment firmsmajor investment companiessmall business loansassets lay dormantcurrent assets dividedcorporate finance alternativebased blockchain appsmedium term notescapitalised lending platformslow risky mannermain motive weighslow technological riskproject finance alternativehigh initial investmentgood working capitalhealthy working capitalcurrent mining cryptocurrenciesextending payment termsnegotiate payment termsoutlines important differencessponsoring firm&rsquogreater success negotiatingpay stable capitalsterm business loanintended business objectivessimilar business modellarge buyers basedaccounts receivables processhigher doesn&rsquosupport local communitiescurrent accounts payablecurrent accounts receivableaverage inventory turnsexisting firm livefree corporate financestructured financing techniqueworld cryptocurrency marketgood payment termsfund operating costscash flow generatedinternal cash flowproject finance differenceproject sponsor pursuesworking capital financingworking capital ratioplanning business developmentbusiness finance designedworking capital financedworking capital situationspecific growth projectsproject finance meansbusiness isn&rsquosmall business&rsquogood credit termscustomers don&rsquorapidly growing globalfinbusinesses weren&rsquorelated industry sourcesglobal informationfinancial servicesleading firmsblockchain platformsadditional capitalcalculated basedterm loanclear objectiveapp storeexisting firmcorporate financeworking capitaldata collectedbased appsproject financefinancial freedomfinancial instrumentsfinancial planningfinancial obligationsbusinesses find difficultloan reimbursementdapp marketplacescurrent liabilitiescurrent assetsbillion worthjointly investedconsidered satisfactoryheat generatedindustrial projectspayment processsponsors undertakinghealthy flowattracting investmentgather blockchaindapp marketincluding ethereumcurrent meanscombined entitytraditional lendersspecific sectorsoperating costsalternative methodsplatform designedinvest capitalsurplus capitalpayment cycledappradar leadingproviding equitynaspers venturesmine cryptocurrenciesexpected objectivesrelated articlesmaking profitgood relationshiplocal governmentdapp projectsmunicipalized companiesmultinational companiesapp marketplacesmall businessesaccounts payableaccounts receivableattracted investmentsolar energyliabilities&mdashcash flowsterm experienceterm infrastructureterm obligationsterm payablesstructured financingnegative territorycoin miningworking&rsquobusiness&mdashpredictable marketdomestic marketexisting shareholderscorporate financingcash flowapproach&mdashreason termsgood optionbusinesses requirerenewable energyinventory sitspurchase inventoryproject financingbusiness ownerstextile businessbusiness ownerretail businessbusiness unprofitablebusiness thirstaverage numbermajor sourcecapital repaymentliquidating assetsremaining assetsdon&rsquosubstantial returnmanufacturing processproduct dependsbreezing benefitsstandby lettersophisticated investorsfourth quarterincrease revenueaccounting mumbolender considersexplicitly designedperiodic paymentssingle buyereconomy forwardhandled easilylarge portiondownstream integratedforward thinkersdistribution channelunique algorithmsaims centersouth koreasafely spendlarge ordermissing opportunitiesattracting attentionsupporting evidencenegatively impactroughly halfhigh propensitybuy stockcloses partnerschallenging taskcommon threadstart todaylandscape contractorsprofit dealscreate jobstrouble meetinginforms investorslimitedreferral programseparate liveswind powermini hydrobig billsseparate incorporationgiving hopesprovide informationextremely forbiddenlonger peakingsouth africascale expansiongeneral ideaplan aheadexcellent organisationbillion wonlending directlyfine tuneaffordable ratestruggle fuelingpower supplyoperates remotelysecurity settingsprevent fraudshared missionduly notepower productionoil extractionassisting thousandsthread runsrecent studiessecurity reasonsbasic understandingelectricity pricemine bitcoinssimilar kindproject fundscapital requirementsgood future&ndashterm gapfinancing optionsreduce costscredit union: trade credit:credit profileindubitable servicemarket conditionsborrowed fundsdistributes dappssupplier payableresidual fundsproject creditorscompany operatingdirect manufacturingcreate profitsonline lendersnet profitsgrowing interestinfrastructure sectorsbig contractbigger contractbalance sheetpay contractspay debtspay dividendsbusiness&rsquobank guaranteebusiness organizationsimportant ratioclient&rsquoapple&rsquosingapore&rsquoinvestors&rsquochina&rsquofinancing optiondebt defaultlargest shareholderyear contractsinstruments varyklip&rdquostrategic investorowed duecommonly definedrun plantsinvestors sharework hardlife comfortablyefficient resultsll findll recognizeluminous futurelong&mdashcompany aimstech companyattracting fundingcover paymentscredit lineoffer leasingpay interestbank instrumentsbuilt globalfininvestments globalfinincreasing numberusers downloadquickly accessiblecommon typescredit: linesfinancediffers dependinganalysisbusinesses turnsmallsponsorspay suppliersinvestmenteasy accessblockchainworkingentityincludingservicesmediumrequiremake sensefundcapitalbasedpaymentcompaniescreated&ldquobuildproblemstermminingguaranteenegativemarketventurescustomersnaspersprojectaccounts&mdashtermsliabilitiesinventorybusinessassetssourcesfreegrowingprovideplanningriskydebtinvestorsprojectssupportlendingdesignedgrowthdifferenceexperienceriskhighfairlivefindmotiveinvestsponsorlargecashfinancingratiocreditservicefundsnumbermeansimportantbalancesuccessoptionlenderssituationfinancedmanufacturingsectorsinterestcontractprofitsdifficultpay£&rsquosenserundueinvestorvarylifeefficientyearhardmarketplacebusinessesworld&rdquoattractedgapdefinedturnlargestdifferskindeasycreditorsrepaymentshareequitydependingconditionsorganizationssupplierreduceincreasinglinedefaultindustryfuturellcompanylinessourcefundingcoverofferaccessrequirementsbankglobalfindappsquicklyuserssuppliersdappradartypeslongmake

Domain Information
#Whois
Host : globalfin.io
Registrar : Gandi SAS

Nameservers :
ns-276.awsdns-34.com (205.251.193.20)
ns-938.awsdns-53.net (205.251.195.170)
ns-1368.awsdns-43.org (205.251.197.88)
ns-2029.awsdns-61.co.uk (205.251.199.237)

Created :2020-02-11
Expires :2021-02-11
Updated :2020-02-11

Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP X2hour
19 hours ago
0.1
New HYIP Comexbit.com
22 hours ago
3.1
New HYIP Cocopay
1 day ago
0.1
New HYIP Waxhour
22 Apr 2025
0.1
New HYIP Infinityprofits
22 Apr 2025
2.0
New HYIP Empirerun
22 Apr 2025
1.8
New HYIP Ramonainv
22 Apr 2025
1.4
Latest Events
Recent event
Yaccuura
Sqmonitor 2 hours ago
changed | waiting » paying
Recent event
Ton-Bitcoin.com
Hyipclub 5 hours ago
changed | paying » not paid
Recent event
Zenpay
Tradinghyips 5 hours ago
removed | paying
Recent event
Asuhour
Ishprash 5 hours ago
removed | paying
Recent event
Bitmote Limited
Hothyips 5 hours ago
removed | paying
Recent event
Stable Grow
Sqmonitor 13 hours ago
changed | paying » waiting
Recent event
Aitimart
Hyipclub 15 hours ago
changed | paying » waiting
Problematic HYIP & Scam
Zenpay
Closed: 5 hours ago
Asuhour
Closed: 5 hours ago
Cwopaid
Closed: 1 day ago
Vanguard Analytics Ltd
Closed: 1 day ago
Assets Aliged
Closed: 1 day ago
Baxhour
Closed: 23 Apr 2025
Zmxpaid
Closed: 22 Apr 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback