Check out HYIPs with HYIP.biz
Reviews+1 | Payouts+11 |  Blacklist |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 25 Apr 2025 05:25:58
Last Update: 25 Apr 2025 05:00:03
 
Join with: 
 
Glass Robot
0.0
Glass Robot
+
Added: Sep 19,2024 17:55
Closed: Sep 21,2024 [2 days]
Payment systems:
Features:
ddos protection
Not Paying2
Plans: 4.4% hourly for 24 Hours, 110% after 1 Day, 240% after 5 Days
Min deposit: $1
Max deposit: $∞
Referral: 3 Levels: 7% - 1% - 1%
Withdrawal: Instant
Total deposited: $804 586 views [31 clicks] Reviews: 000
Forum(s): DTMRCDMTMM4
Telegram(s): @glassrobotcc

«Glass Robot» summary

This «RiskRank» metric is a general litmus test for the quality of the «Glass Robot» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of glassrobot.cc and the results from 0 to 10 points.

glassrobot.cc good quality signs:

  • The website uses Sectigo Limited SSL encryption. All of the incoming and outdoing content is encrypted;
  • Not a poor hosting solution looks like a stable and secure server;
  • The website content is unique;
  • Has a licenced GoldCoders script;
  • Featured on a reputable HYIP monitoring platforms;

glassrobot.cc red flags:

  • Plagiarized design elements from other HYIPs;
  • IP 185.186.54.18 that occurs elsewhere for 16 HYIP;
0.0
This project is a scam and stops paying on Sep 21, 2024.
Domain: glassrobot.cc is registered for a 1 year by PDR Ltd. d/b/a PublicDomainRegistry.com
[from Sep 19,2024 to Sep 19,2025]
~
ssl SSL valid for a 12 months - Sectigo Limited
+
Licensed Script: GoldCoders - Licensed
+
Dedicated Server  Dedicated server - 14 domains hosted on IP: 185.186.54.18
+
Hosting: Genius-Security-Ltd [ geniusguard.com ] +
IP: 185.186.54.18 [used in: 16 projects]
Network: 185.186.x.x [192 projects] United Kingdom
-
Found similar content [design: 1 project]
-

Latest Reviews
Be first to add a vote/review and share your statement about "glassrobot.cc"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 19
not paid
21 Sep 2024
$300 25%
75 USD
20 Sep 2024
7 months ago
waiting » not paid
7 months ago
19 Sep 2024
7 months ago
+ InstantMonitor 62
not paid
23 Sep 2024
$300 24%
72 USD
20 Sep 2024
7 months ago
waiting » not paid
7 months ago
19 Sep 2024
7 months ago
RCB Deposit Flow
 
20 Sep 2024
RCB
$639.00
$80.59
9 deposits
min: $25 max: $344 avg: $71
19 Sep 2024
RCB
$115.00
$11.16
4 deposits
min: $25 max: $40 avg: $29
Summary of Deposits
updated: Sep 21,2024 08:12:02
InstantMonitor
RCB
$619.00
$71.12
8 deposits
min: $25 max: $344 avg: $78
InvesTracing
RCB
$135.00
$20.63
5 deposits
min: $25 max: $30 avg: $27

Content
#Tags

Here's what it says on the glassrobot.cc website:

GLASS ROBOT is an investment platform that uses artificial intelligence and robotics technologies to analyze and automate investment decisions in cryptocurrency assets. The core concept is to create a transparent, robot-driven platform that optimizes investment strategies based on big data and predictive models. You don't need to get into complex details. All you need to do is choose the right deposit plan and the platform will automatically start earning for you using advanced AI algorithms and cryptocurrency market analytics. We offer a fully automated process with a transparent income accrual system, so you can see the performance of your deposit without being distracted by the details. The GLASS ROBOT platform operates 24/7, without weekends and holidays. Artificial intelligence analyzes the market and makes decisions in real time, allowing you to profit from any market situation, even when you sleep. The platform's referral program allows users to earn not only on their investments, but also receive rewards from investments of friends and their referrals up to the third level, which makes the program one of the most generous on the market. GLASS ROBOT LTD is registered in the UK, which guarantees high security standards and compliance with strict international financial regulations. This strengthens user confidence in the platform and ensures reliable legal protection. The unique feature of GLASS ROBOT is simplicity for users. An investor does not need to track market trends or understand complex charts - just open a deposit, and the robot will manage investments automatically, bringing stable accruals. GLASS ROBOT LTD is an officially registered UK-based financial technology company specializing in the automation of investment processes using artificial intelligence and robotics. We offer innovative solutions for managing cryptocurrency assets, providing our clients with simplicity and reliability in the world of digital finance. The company follows strict international standards in financial technology, which guarantees transparency and security of all transactions on the platform. Thanks to our UK registration, we operate within one of the most trusted and regulated financial markets in the world. Join our referral program and start earning extra income by inviting friends and partners to the GLASS ROBOT platform. Our tiered program offers generous rewards at every stage!How it works: When you invite new users to the platform through your unique referral link, you receive a percentage of their investment for three tiers:Level 1: Earn 7% of all investments made by your direct referrals (those you personally invited).
Glass Robotunique solution: robot investors capablebased financial technology company specializingtiered program offers generous rewardsensures reliable legal protectionstart earning extra incomeoptimizes investment strategies basedstrict international financial regulationstransparent income accrual systempartnership program cryptocurrency immersecombines advanced artificial intelligenceguarantees high security standardsstrict international standardsglass robot platform operatesautomatically start earningregulated financial marketsadvanced ai algorithmsstrengthens user confidencefully automated processbringing stable accrualsunique referral linkmaking optimal decisionsunderstand complex chartsmanaging cryptocurrency assetsartificial intelligence analyzespredicting market trendstrack market trendsautomate investment decisionscryptocurrency market analyticsoffer innovative solutionsfinancial technologyofficially registered ukmanage investments automaticallyglass robot platformunique featurecryptocurrency assetsartificial intelligencereferral programguarantees transparencyreceive rewardsglass robotcryptocurrency investmentsinvestment processestransparent investmentsmarket situationmakes decisionsinvestment platformuk registrationpredictive modelstech financecore conceptanalyzing millionsreal timedigital financecomplex detailsinvestments madedriven platformparticipants invitedpersonally inviteddirect referralsautomation technologiesrobotics technologiesbig datatiers:leveldeposit planinviting friendscompanygenerouslevel referralsprogramsecurityhighinvestmentrobottransparentmarketukmanageregisteredinvestmentsplatforminvitedofferautomationreceiveroboticsreferralsdatamakesdetailslevelfriendsdeposit

Domain Information
#Whois
Host : glassrobot.cc
Registrar : PDR Ltd. d/b/a PublicDomainRegistry.com

Nameservers :
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)

Created :2024-09-19
Expires :2025-09-19
Updated :2024-09-19

Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP X2hour
14 hours ago
0.1
New HYIP Comexbit.com
17 hours ago
3.1
New HYIP Cocopay
1 day ago
0.1
New HYIP Waxhour
22 Apr 2025
0.1
New HYIP Infinityprofits
22 Apr 2025
2.0
New HYIP Empirerun
22 Apr 2025
1.8
New HYIP Ramonainv
22 Apr 2025
1.4
Latest Events
Recent event
Ton-Bitcoin.com
Hyipclub 25 minutes ago
changed | paying » not paid
Recent event
Zenpay
Tradinghyips 25 minutes ago
removed | paying
Recent event
Asuhour
Ishprash 25 minutes ago
removed | paying
Recent event
Bitmote Limited
Hothyips 25 minutes ago
removed | paying
Recent event
Stable Grow
Sqmonitor 8 hours ago
changed | paying » waiting
Recent event
Aitimart
Hyipclub 10 hours ago
changed | paying » waiting
Recent event
X2hour
Tradinghyips 14 hours ago
added | paying
Problematic HYIP & Scam
Zenpay
Closed: 25 minutes ago
Asuhour
Closed: 25 minutes ago
Cwopaid
Closed: 1 day ago
Vanguard Analytics Ltd
Closed: 1 day ago
Assets Aliged
Closed: 1 day ago
Baxhour
Closed: 23 Apr 2025
Zmxpaid
Closed: 22 Apr 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback