Server Time: 21 Jun 2025 10:19:46
Last Update: 21 Jun 2025 10:00:03
Telegram
 
Join with: 
Glass Robot
Reviews: 000
[620 views]
[32 clicks]
Glass Robot
Added: Sep 19,2024 17:55
Closed: Sep 21,2024 [2 days]
Not Paying2
Payment systems:
Features:
SSLDDOS protection
Plans: 4.4% hourly for 24 Hours, 110% after 1 Day, 240% after 5 Days
Min deposit: $1 Max deposit: $∞
Referral: 3 Levels: 7% - 1% - 1%
Withdrawal: Instant
X
This project is a scam and stopped paying on Sep 21, 2024.
Total deposited: $804
Forum(s): DTMRCDMTMM4
Telegram(s): @glassrobotcc

«Glass Robot» [glassrobot.cc] Summary

The «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Glass Robot», evaluated based on multiple criteria. Below is a detailed analysis of glassrobot.cc, with a score ranging from 0 to 10 points.

Green flags:

  • The website uses Sectigo Limited SSL encryption. All of the incoming and outdoing content is encrypted;
  • The website content is unique;
  • Has a licenced GoldCoders script;
  • Featured on a reputable monitoring platforms;

Red flags:

  • Plans:2/3 flagged red;
  • Plagiarized design elements from other HYIPs;
  • IP 185.186.54.18 that occurs elsewhere for 16 HYIP;
Domain: glassrobot.cc is registered for a 1 year by PDR Ltd. d/b/a PublicDomainRegistry.com
[from Sep 19,2024 to Sep 19,2025]
~
ssl SSL valid for a 12 months - Sectigo Limited
+
Licensed Script: GoldCoders - Licensed
+
Dedicated Server  Dedicated server - IP address 185.186.54.18 hosts 14 domains
+
Hosting: Genius Guard [ geniusguard.com ] +
IP: 185.186.54.18 [used in: 16 projects]
Network: 185.186.x.x [199 projects] United Kingdom
-
Found similar content [design: 1 project]
-

Latest Reviews
Be first to add a vote/review and share your statement about "glassrobot.cc"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 19
not paid
21 Sep 2024
$300 25%
75 USD
20 Sep 2024
9 months ago
waiting » not paid
9 months ago
19 Sep 2024
9 months ago
+ InstantMonitor 62
not paid
23 Sep 2024
$300 24%
72 USD
20 Sep 2024
9 months ago
waiting » not paid
9 months ago
19 Sep 2024
9 months ago
RCB Deposit Flow
 
20 Sep 2024
RCB
$639.00
$80.59
9 deposits
min: $25 max: $344 avg: $71
19 Sep 2024
RCB
$115.00
$11.16
4 deposits
min: $25 max: $40 avg: $29
Summary of Deposits
updated: Sep 21,2024 08:12:02
InstantMonitor
RCB
$619.00
$71.12
8 deposits
min: $25 max: $344 avg: $78
InvesTracing
RCB
$135.00
$20.63
5 deposits
min: $25 max: $30 avg: $27

Content
#Tags

Here's what it says on the glassrobot.cc website:

GLASS ROBOT is an investment platform that uses artificial intelligence and robotics technologies to analyze and automate investment decisions in cryptocurrency assets. The core concept is to create a transparent, robot-driven platform that optimizes investment strategies based on big data and predictive models. You don't need to get into complex details. All you need to do is choose the right deposit plan and the platform will automatically start earning for you using advanced AI algorithms and cryptocurrency market analytics. We offer a fully automated process with a transparent income accrual system, so you can see the performance of your deposit without being distracted by the details. The GLASS ROBOT platform operates 24/7, without weekends and holidays. Artificial intelligence analyzes the market and makes decisions in real time, allowing you to profit from any market situation, even when you sleep. The platform's referral program allows users to earn not only on their investments, but also receive rewards from investments of friends and their referrals up to the third level, which makes the program one of the most generous on the market. GLASS ROBOT LTD is registered in the UK, which guarantees high security standards and compliance with strict international financial regulations. This strengthens user confidence in the platform and ensures reliable legal protection. The unique feature of GLASS ROBOT is simplicity for users. An investor does not need to track market trends or understand complex charts - just open a deposit, and the robot will manage investments automatically, bringing stable accruals. GLASS ROBOT LTD is an officially registered UK-based financial technology company specializing in the automation of investment processes using artificial intelligence and robotics. We offer innovative solutions for managing cryptocurrency assets, providing our clients with simplicity and reliability in the world of digital finance. The company follows strict international standards in financial technology, which guarantees transparency and security of all transactions on the platform. Thanks to our UK registration, we operate within one of the most trusted and regulated financial markets in the world. Join our referral program and start earning extra income by inviting friends and partners to the GLASS ROBOT platform. Our tiered program offers generous rewards at every stage!How it works: When you invite new users to the platform through your unique referral link, you receive a percentage of their investment for three tiers:Level 1: Earn 7% of all investments made by your direct referrals (those you personally invited).
Glass Robotunique solution: robot investors capablebased financial technology company specializingtiered program offers generous rewardsensures reliable legal protectionstart earning extra incomeoptimizes investment strategies basedstrict international financial regulationstransparent income accrual systempartnership program cryptocurrency immersecombines advanced artificial intelligenceguarantees high security standardsstrict international standardsglass robot platform operatesautomatically start earningregulated financial marketsadvanced ai algorithmsstrengthens user confidencefully automated processbringing stable accrualsunique referral linkmaking optimal decisionsunderstand complex chartsmanaging cryptocurrency assetsartificial intelligence analyzespredicting market trendstrack market trendsautomate investment decisionscryptocurrency market analyticsoffer innovative solutionsfinancial technologyofficially registered ukmanage investments automaticallyglass robot platformunique featurecryptocurrency assetsartificial intelligencereferral programguarantees transparencyreceive rewardsglass robotcryptocurrency investmentsinvestment processestransparent investmentsmarket situationmakes decisionsinvestment platformuk registrationpredictive modelstech financecore conceptanalyzing millionsreal timedigital financecomplex detailsinvestments madedriven platformparticipants invitedpersonally inviteddirect referralsautomation technologiesrobotics technologiesbig datatiers:leveldeposit planinviting friendscompanygenerouslevel referralsprogramsecurityhighinvestmentrobottransparentmarketukmanageregisteredinvestmentsplatforminvitedofferautomationreceiveroboticsreferralsdatamakesdetailslevelfriendsdeposit

Domain Information
#Whois
Host : glassrobot.cc
Registrar : PDR Ltd. d/b/a PublicDomainRegistry.com

Nameservers :
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)

Created :2024-09-19
Expires :2025-09-19
Updated :2024-09-19

Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Cryptxtrade.org
Invested: $150
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Kraventa
11 hours ago
3.4
New HYIP Exp-Pay
19 hours ago
0.1
New HYIP Perfect-Train
1 day ago
0.1
New HYIP Oil-Clock
18 Jun 2025
0.1
New HYIP Exoledger Ltd
18 Jun 2025
3.9
New HYIP Bitifi Bot
18 Jun 2025
4.1
New HYIP Felos
18 Jun 2025
2.4
Latest Events
Recent event
Kraventa
Instantmonitor 4 hours ago
added | waiting
Recent event
Bitcapitalmine
Tradinghyips 5 hours ago
removed | paying
Recent event
Axen-Clock
Ishprash 5 hours ago
removed | paying
Recent event
Fin-Solutions Ltd
Investracing 9 hours ago
changed | paying » not paid
Recent event
Flip X
Investracing 10 hours ago
changed | paying » waiting
Recent event
Kraventa
Investracing 11 hours ago
added | waiting
Recent event
Exp-Pay
Ishprash 19 hours ago
added | paying
Problematic HYIP & Scam
Bitcapitalmine
Closed: 5 hours ago
Axen-Clock
Closed: 5 hours ago
Fin-Solutions Ltd
Closed: 9 hours ago
Go-Train
Closed: 1 day ago
Nemo-Pay
Closed: 19 Jun 2025
Cow-Pay
Closed: 18 Jun 2025
Gentius Ltd
Closed: 18 Jun 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback