Server Time: 04 Jun 2025 06:15:16
Last Update: 04 Jun 2025 06:00:02
Telegram
 
Join with: 
Funds Gain
Reviews: 000
430 views
[10 clicks]
Funds Gain
Added: Nov 08,2010 10:06
Extreme Risk!
Not Paying1
Payment systems:
Features:
Dedicated Server
Plans: 2-3% daily
Min deposit: $ 10 Max deposit: $∞
Referral: 4-5%
X
This project is a scam.

«Funds Gain» [fundsgain.com] Summary

The «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Funds Gain», evaluated based on multiple criteria. Below is a detailed analysis of fundsgain.com, with a score ranging from 0 to 10 points.

Green flags:

  • Plans: 1/1 flagged green;
  • Excellent hosting: Very few sites on this IP guarantee superior response times and reliable access;
  • The website content is unique;
  • Featured on a reputable monitoring platforms;
Hosting: eNET Inc. [ ee.net ] +
IP: 207.182.137.154 [used in: 2 projects]
Network: 207.182.x.x [11 projects] United States
-

Similarities of fundsgain.com based on statistic researching

Here are closed projects with similar payouts plans as 2-3% daily and included other metrics;
that's stopped pay after min: 5 max: 98 avg: 28 days from a project start date.
Found [2694 projects] with proximate payouts plans in total.

Latest Reviews
Be first to add a vote/review and share your statement about "fundsgain.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Increase your affiliate commission most easily!

Content
#Tags

Here's what it says on the fundsgain.com website:

The main goal of our activity is provide you with right solutions. You will have definitely a good start with us! Thank you for taking the time to visit our site and allowing us to provide you with an overview of our structure, philosophy. First and foremost, our primary mission emulates perfectly the underlying axiom that grounds every commitment made by fundsgain.com in its investigation and search for reliable, industry competitive investment returns. In today's rapidly changing, complex markets that demand immediate, reflexive accommodation, that old premise that he who walks away gets to play another day, has never had more relevance. Hence, fundsgain.com is slave to the principle of 'Preservation of Capital. This concept is of the utmost importance and grounds our investment philosophy. fundsgain.com was established in May 2007. The managers at fundsgain.com came together for the sole purpose of developing a unique synergy among experienced financial professionals, who have specialized in different aspects and functions of current markets in order that comprehensive, adaptive solutions that reinforce the fundsgain.com mandate remains paramount and achievable at each juncture in time. fundsgain.com understands that the fundamental basis for superlative secular returns is a primary understanding of primary trends in various markets. As an example, in a stock market categorized as in a bull market phase, seven out of ten stocks will rise. In contrast, during a bear phase nine out of ten stocks will decline. The collective insight of our professionals into diversified markets will set out with a high probability of reliability the primary and future trend of the target market, while as necessary minimizing and resisting any downside exposure by not fighting these underlying powerful trends. The next step in the fundsgain.com approach accesses appropriate financial vehicles to exploit fundsgain.com's exclusive assumptions, and permits fundsgain.com clients to participate in more market friendly environments. A fundsgain.com principle is to 'ride the tide, not fight the wave'. As specialists in world financial markets, we enable investors to capitalize on a wide array of investment opportunities around the globe, including high growth securities on all major stock markets of the world, bonds, mutual funds, options, insurance, and annuities. We also trade actively on the Forex market. We do not limit our operations only to online trading, we are also involved in a number of long-term investment projects that even thought they are not as profitable as securities and currencies trading, are worth investing in. Because we work with currency exchange trading on a daily basis in the Forex currency market, we clearly understand how difficult and time consuming it would be for an investor who wants to take advantage of the potential opportunities in the 24-hour foreign currency market and lacks both the time and experience to trade on their own. And at the same time conduct important technical analysis and hourly price chart studies including important economic data. Our aim is to provide our clientele with well thought out trading ideas and strong emphasis on risk management techniques utilizing sell stop loss and limit orders to optimize capital preservation. Our approach to trading is based entirely on Technical, Fundamental Analysis with full attention focused on the spot cash currency market and price action of the different major currency pairs applying our system with greater emphasis on hourly price chart studies in our attempt to generate good entry and exit signals. .
Funds Gainhourly price chart studies including important economic datarisk management techniques utilizing sell stop losshourly price chart studiestime conduct important technical analysisincluding high growth securitiesmajor currency pairs applyingspot cash currency markethour foreign currency marketprimary mission emulates perfectlyindustry competitive investment returnssuperlative secular returnsforex currency marketstock market categorizedmandate remains paramountmarket friendly environmentsfull attention focusedterm investment projectsmajor stock marketscurrency exchange tradingbull market phasegenerate good entryunderlying powerful trendsexperienced financial professionalsoptimize capital preservationworld financial marketsprice actionforex marketfundamental analysishigh probabilitytarget marketprimary trendsinvestment opportunitiesfinancial vehiclesgood startbear phaseunderlying axiomprimary understandinginvestment philosophydiversified marketscomplex marketscurrent marketscollective insightfuture trendten stocksexit signalsenable investorsdaily basisworth investingtime consumingpotential opportunitiesstrong emphasiscurrencies tradingonline tradingtrading ideasexclusive assumptionswide arraygreater emphasismutual fundsmain goaldownside exposurerapidly changingfundamental basissole purposecommitment madeutmost importancereflexive accommodationunique synergytrade activelyadaptive solutionslimit ordersapproach accessesexploit fundsgainpermits fundsgaintechnicalsecuritiesprimarymarketstimecapitalworldtradingprofessionalspreservationtradephilosophysolutionslimitapproachfundsgain

Domain Information
#Whois
Domain : fundsgain.com
IP :
184.73.226.63
Domain Info : Google PR :

      fundsgain.com
     www.fundsgain.com


Alexa's rank : 0
 
RAW Whois : NOT FOUND
Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

No match for "FUNDSGAIN.COM".
>>> Last update of whois database: Tue, 21 Jul 2015 18:32:28 GMT <<<

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Cryptxtrade.org
Invested: $150
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Frogs Wallet
15 hours ago
2.8
New HYIP Easy-Train
16 hours ago
0.1
New HYIP Motex-Gain
1 day ago
0.1
New HYIP Suro
1 day ago
1.4
New HYIP Kanex-Pay
01 Jun 2025
0.1
New HYIP Cova-Pay
31 May 2025
0.1
New HYIP Quebb
30 May 2025
5.4
Latest Events
Recent event
Veridion Trading
Eurohyips 1 hour ago
removed | paying
Recent event
Samex-Clock
Ishprash 1 hour ago
removed | paying
Recent event
Veridion Trading
Sqmonitor 1 hour ago
changed | problem » not paid
Recent event
Synox Mining
Investracing 4 hours ago
changed | paying » waiting
Recent event
Zevatra
Investracing 4 hours ago
changed | paying » not paid
Recent event
Vanguard Analytics Ltd
Hyipexplorer 5 hours ago
changed | problem » not paid
Recent event
Olive-Am.pro
Hyipclub 10 hours ago
changed | waiting » paying
Problematic HYIP & Scam
Samex-Clock
Closed: 1 hour ago
Zevatra
Closed: 4 hours ago
Veridion Trading
Closed: 18 hours ago
Trxs
Closed: 1 day ago
Uctraders Limited
Closed: 1 day ago
Color-Pay
Closed: 02 Jun 2025
Woxahour
Closed: 01 Jun 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback