Check out HYIPs with HYIP.biz
Reviews+21 | Payouts+27 |  Blacklist+4 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 26 Apr 2024 12:02:42
Last Update: 26 Apr 2024 12:00:02
 
Join with: 
 
Earn - Gold2u
0.0
Earn - Gold2u
+
Added: Jan 05,2011 08:04
Closed: May 13,2011 [128 days]
Payment systems:
Not Paying1
Plans: 0.1-0.5% daily or 6-8% monthly
Min deposit: $ 10
Max deposit: $∞
Referral: 0.5-2%
190 views [1 click] Reviews: 000
Hosting: Microsoft Corporation [ microsoft.com ] +
IP: 202.71.106.125 [not used in other projects]
Network: 20.33.x.x [2 projects] Malaysia
+

Latest Reviews
Be first to add a vote/review and share your statement about "earn-gold2u.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

Content
#Tags

Here's what it says on the earn-gold2u.com website:

Our program is intended for people willing to achieve their financial freedom but unable to do so because they're not financial experts. Earn-Gold2u is a long term high yield private loan program, backed up by Arowana Market trading and investing in various funds and activities. Profits from these investments are used to enhance our program and increase its stability for the long term. All payments are made to your account Daily/Weekly/Monthly. You may make an additional spend as many times as you like. Our other levels referral bonuses (not depending on the number of referrals): Level 2: 0.01% Level 3: 0.01% Level 4: 0.01% Level 5: 0.01% Our Commissions Percentage Target is only Calculate for available referrals. Which referrals who sign up but dint invest is not count in our Commissions Target.Merry Christmas & Happy New Year Wish all of Earn-Gold Member Merry Christmas & Happy New Year~ Dec-29-2010 11:50:01 PMEarn-Gold2u have a changes‏ So happy to send you this e-mail to inform you about the big good news.Earn-Gold2u have make a bit changes. We need all of you support.After discussion, we decided to change our investment program. Please attend our website to view our new investment package.For all the investor who already deposit on the old package, we'll change yourinvestment plan according to your original package.Orientation Plan is for whose investor did not trust us will paying, we let you tryfor 1 month. We guaranty that we will paying to your LR account for everywithdrawals request.Please give us your support.You may go to our facebook to 'LIKE' us.http://www.facebook.com/pages/Earn-Gold2u/149884911715277We really need all of you support to get more and more profit.Thanks & Best Regards,Kenny KooDirector Main Website: http://www.earn-gold2u.comBBS Forum: http://bbs.earn-gold2u.comEarn-Gold2u Facebook: http://www.facebook.com/pages/Earn-Gold2u/149884911715277 Nov-7-2010 06:49:03 PMFacebook @ Earn-Gold2u is Start!! Our Facebook Homepage is create~ Member can go our Facebook Like us~http://www.facebook.com/profile.
Earn - Gold2ulong term high yield private loan programkenny koodirector main website: http://wwwgold member merry christmas & happycombbs forum: http://bbsaccount daily/weekly/monthlyll change yourinvestment planmerry christmas & happylong termarowana market tradingbig good news:47 pmabout low interestlevels referral bonusesfacebook: http://wwwcommissions percentage targethigh interesthttp://www~http://wwwcreate~ membercommissions targetlr accountreferral programinvestment planorientation planinvestment programreferral depositsfinancial freedomfinancial expertsadditional spendminimum spendeverywithdrawals requestinvestment packageaminvestment packageoriginal packagedint investyear~ decwebsitefacebook homepage/pages/earnpmfacebook @ earnstart operationhappyprogramchangepackageinvestyearfacebookgoldstartearn

Domain Information
#Whois
Domain : earn-gold2u.com
IP :
184.73.226.63
Domain Info : Google PR :

      earn-gold2u.com
     www.earn-gold2u.com


Alexa's rank : 0
 
RAW Whois : NOT FOUND
Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

No match for "EARN-GOLD2U.COM".
>>> Last update of whois database: Thu, 30 Apr 2015 21:30:14 GMT <<<

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
Monitoring
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Taplex
21 hours ago
0.1
New HYIP Stablemomey
1 day ago
3.5
New HYIP Aerobite
1 day ago
0.2
New HYIP Pxm-Hour
1 day ago
0.1
New HYIP Favometal
24 Apr 2024
0.1
New HYIP Bitmote Limited
23 Apr 2024
1.2
New HYIP Speed-Gain
23 Apr 2024
0.1
Latest Events
Recent event
Taplex
Hyipclub 2 hours ago
added | paying
Recent event
Vintal
Hyipclub 4 hours ago
added | paying
Recent event
Cfg Liberty
Hyipexplorer 4 hours ago
changed | waiting » paying
Recent event
Agros.au
Hyipclub 6 hours ago
changed | problem » not paid
Recent event
Cryptomines
Hyipsinfo 6 hours ago
removed | problem
Recent event
Defi Profit Limited
Hyipsinfo 6 hours ago
removed | problem
Recent event
Pro Invest
Hyipsinfo 7 hours ago
removed | problem
Problematic HYIP & Scam
Best-Gold
Closed: 7 hours ago
Cryptonova
Closed: 7 hours ago
Hitbit
Closed: 7 hours ago
Auracasa Ltd
Closed: 7 hours ago
Valery Ai
Closed: 13 hours ago
Dior-Hour
Closed: 1 day ago
Speed-Metal
Closed: 1 day ago
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback