Check out HYIPs with HYIP.biz
Reviews+10 | Payouts+31 |  Blacklist+2 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 25 Apr 2025 21:24:58
Last Update: 25 Apr 2025 21:00:02
 
Join with: 
 
Diverse Money Corp
0.0
Diverse Money Corp
+
Added: Sep 17,2012 01:00
Closed: Feb 16,2013 [152 days]
Payment systems:
Features:
ddos protection
Not Paying5
Plans: 0% - 4.5% daily for 20 trading days and principal back, 135%...
Min deposit: $25
Max deposit: $25000
Referral: n/a
Withdrawal: Automatic
582 views [46 clicks] Reviews: 000

«Diverse Money Corp» summary

This «RiskRank» metric is a general litmus test for the quality of the «Diverse Money Corp» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of diversemoneycorp.com and the results from 0 to 10 points.

diversemoneycorp.com good quality signs:

  • Good hosting ensures the proper response level and excellent website access;
  • The website content is unique;
  • IP address not used by other HYIPs;

diversemoneycorp.com red flags:

  • Free SSL without a confidence guarantee;
  • Not featured on reputable HYIP monitoring platforms;
0.0
This project is a scam and stops paying on Feb 16, 2013.
Hosting: CloudFlare, Inc. [ cloudflare.com ] +
IP: 108.162.192.86 [not used in other projects]
Network: 108.162.x.x [456 projects] United States
+

Latest Reviews
Be first to add a vote/review and share your statement about "diversemoneycorp.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 57
not paid
15 Feb 2013
$50 124%
62 USD
08 Feb 2013
12 years ago
24 Dec 2012
12 years ago
+ HYIPs-Analysis 59
not paid
19 Feb 2013
- -
12 Feb 2013
12 years ago
17 Sep 2012
12 years ago
+ SQMonitor 57
not paid
24 Feb 2013
$30 143%
42.9 USD
18 Feb 2013
12 years ago
17 Sep 2012
12 years ago

Content
#Tags

Here's what it says on the diversemoneycorp.com website:

Home Page Read Company History View Performance history Start Investing View Current Ratings FAQ Section Client Support Our investment plans are very simple. We offer a variable daily plan and a fixed monthly plan. During each business day, clients will received their variable earnings. This figure will all depend on our performance and will already include our 25% performance fee. Our monthly plan is at a fixed rate of 35% profit after 20 business days which includes the 25% performmance fee factored in. In majority of cases, clients will earn more with the monthly plan simply due to the fact that your funds are held longer without a daily payment. This gives us extra time to generate more money with your investment without the interruption of paying out daily. Your principal is returned upon maturity. Please note that major holidays are NOT considered a business day even if it falls on a day which would normally be considered a business day. Variable: Daily interest for 20 business days Fixed: 35% fixed interest after 20 business days Principal returned for both plans Diverse Money Corp has decided to go with the most tradition but yet most secured method of investor money protection. We have chosen to discard any use of website scripts for member back end areas. Scripts at many times can be unreliable and even introduce potential threats to the system. We simply prefer to focus our time on generating profits for our clients instead of programming issues. All investments must be made manually directly from your Liberty Reserve or Perfect Money account to ours. You can be assured that there will never be delays in payments regardless if our website is up or down. There will simply be no excuse and you can be assured that you will never miss a payment from Diverse Money Corp regardless if our website is up or down for any reason.Trading in any market is a very risky venture. Most firms focus on the "all your eggs in one basket" method which is typically doomed for failure. Diverse Money Corp focuses on the combination of very profitable trading methods alongside with the diversity in several markets. Our methods have proven to provide a more long term and safer way of investing in high risk markets. Key Benefits 100% scriptless for maximum safety of funds 100% hack proof DDoS Protection Funds are diversified into various markets Offshore company for maximum privacy No withdrawal process required Payments are made automatically Investments secured by company reserves.
Diverse Money Corp% hack proof ddos protection fundsmember back end areasunique money making strategydiverse money corp focusesprofitable trading methods alongsideplans diverse money corpmonthly plan simply duebusiness days principal returnedinvestor money protectiondiverse money corpintroduce potential threatsexcellent customer servicemade manually directlyperfect money account5% performmance fee factoredfixed monthly planvariable daily planprivate investment firmassure timely payments4 separate investment groupsbusiness days fixed:daily trading updatesmarkets offshore companyhigh risk marketsvariable: daily interestmonthly planbusiness daysmoney trading5% fixed interestinvestment plansvariable earningsfixed ratecompany reservessimply preferminimize riskminimizing riskbusiness dayliberty reservetypically doomedrisky ventureheld longergenerating profitsmajor holidayslong termprogramming issueskey benefitsfinally foundequally allocatedlegit programprofessional tradersextra layerinvestment groupmaximum safetymaximum privacydaily payment5% performance feeinvestment marketfirms focusextra timesecured methodmoneywebsite scriptstradingreturnedmethodsprincipaldailysimplymarketsfundspaymentsinvestmentdaymarketfocuspaymentscriptsmethodtimesecuredwebsiteperformance

Domain Information
#Whois
Domain : diversemoneycorp.com
IP :
104.28.15.108
Registrar : GODADDY.COM, LLC
Nameservers :
JIM.NS.CLOUDFLARE.COM (173.245.59.125)
LOLA.NS.CLOUDFLARE.COM (173.245.58.132)
Created : 09-sep-2012
Updated : 13-sep-2012
Expires : 09-sep-2015
Domain Info : Google PR :

      diversemoneycorp.com
     www.diversemoneycorp.com


Alexa's rank : 0
 
RAW Whois : Domain Name: DIVERSEMONEYCORP.COM
Registry Domain ID: 1743827874_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Update Date: 2012-09-13T19:40:09Z
Creation Date: 2012-09-09T21:59:48Z
Registrar Registration Expiration Date: 2015-09-09T21:59:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.480-624-2505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID:
Registrant Name: Mitchell Bosale
Registrant Organization:
Registrant Street: 60 Market Square
Registrant City: Belize City
Registrant State/Province:
Registrant Postal Code: 78583
Registrant Country: Belize
Registrant Phone: +1.5016504896
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: admin@diversemoneycorp.com
Registry Admin ID:
Admin Name: Mitchell Bosale
Admin Organization:
Admin Street: 60 Market Square
Admin City: Belize City
Admin State/Province:
Admin Postal Code: 78583
Admin Country: Belize
Admin Phone: +1.5016504896
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: admin@diversemoneycorp.com
Registry Tech ID:
Tech Name: Mitchell Bosale
Tech Organization:
Tech Street: 60 Market Square
Tech City: Belize City
Tech State/Province:
Tech Postal Code: 78583
Tech Country: Belize
Tech Phone: +1.5016504896
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: admin@diversemoneycorp.com
Name Server: JIM.NS.CLOUDFLARE.COM
Name Server: LOLA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2015-05-08T18:00:00Z

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP X2hour
1 day ago
0.1
New HYIP Comexbit.com
1 day ago
3.1
New HYIP Cocopay
23 Apr 2025
0.1
New HYIP Waxhour
22 Apr 2025
0.1
New HYIP Infinityprofits
22 Apr 2025
2.0
New HYIP Empirerun
22 Apr 2025
1.8
New HYIP Ramonainv
22 Apr 2025
1.4
Latest Events
Recent event
Aitimart
Fairmonitor 1 hour ago
changed | paying » waiting
Recent event
Tradinghyips 5 hours ago
added | paying
Recent event
Nextera Financial
Hyiptop 5 hours ago
added | paying
Recent event
Stinbitz.net
Instantmonitor 6 hours ago
changed | paying » waiting
Recent event
Yaccuura
Sqmonitor 13 hours ago
changed | waiting » paying
Recent event
Ton-Bitcoin.com
Hyipclub 16 hours ago
changed | paying » not paid
Recent event
Zenpay
Tradinghyips 16 hours ago
removed | paying
Problematic HYIP & Scam
Zenpay
Closed: 16 hours ago
Asuhour
Closed: 16 hours ago
Cwopaid
Closed: 1 day ago
Vanguard Analytics Ltd
Closed: 1 day ago
Assets Aliged
Closed: 1 day ago
Baxhour
Closed: 23 Apr 2025
Zmxpaid
Closed: 22 Apr 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback