Check out HYIPs with HYIP.biz
Reviews+4 | Payouts+26 |  Blacklist+2 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 25 Apr 2025 10:52:12
Last Update: 25 Apr 2025 10:00:02
 
Join with: 
 
Biteer
0.0
Biteer
+
Added: Jan 22,2017 00:09
Closed: Apr 05,2017 [73 days]
Payment systems:
Features:
ddos protection
Not Paying2
Plans: 1% - 1.2% daily for lifetime
Min deposit: $1
Max deposit: $∞
Referral: 8%**
Withdrawal: Automatic
641 views [16 clicks] Reviews: 000

«Biteer» summary

This «RiskRank» metric is a general litmus test for the quality of the «Biteer» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of biteer.biz and the results from 0 to 10 points.

biteer.biz good quality signs:

  • The domain biteer.biz is registered for two years, which is a good thing;
  • Good hosting ensures the proper response level and excellent website access;
  • The website content is unique;
  • IP address not used by other HYIPs;
  • Featured on a reputable HYIP monitoring platforms;

biteer.biz red flags:

  • Free SSL without a confidence guarantee;
0.0
This project is a scam and stops paying on Apr 05, 2017.
Domain: biteer.biz is registered for a 2 years by NEULEVEL
[from Dec 04,2016 to Dec 03,2018]
+
ssl PositiveSSL Multi-Domain valid for a 5 months - COMODO CA Limited
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] +
IP: 104.27.147.114 [not used in other projects]
Network: 104.16.x.x [5927 projects] United States
+

Latest Reviews
Be first to add a vote/review and share your statement about "biteer.biz"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ SQMonitor 90
not paid
03 Apr 2017
$65 59%
38.35 USD
05 Mar 2017
8 years ago
problem » not paid
8 years ago
22 Jan 2017
8 years ago
+ Incredible Earnings 58
not paid
25 Mar 2017
$40 156%
62.4 USD
15 Mar 2017
8 years ago
problem » not paid
8 years ago
23 Mar 2017
8 years ago

Content
#Tags

Here's what it says on the biteer.biz website:

2014 Baldwin founded the Biteer studio in University of Reading, 2 years in the use of self made electric energy to extract 10000 bitcoin, and received a number of private mine owners to cooperate with the invitation. in 2015 participated in the Singapore hosted the cloud bitcoin World Conference and proposed an effective solution in the meeting. Biteer Limited in 2016 officially landed in London, and many of the world's private mining cooperation. Biteer provides new energy technologies and cloud computing for many mining. At the same time to provide investors with private mining services. In order to improve yield, 2017 we will build more "Super cloud mining", investors can get good returns by investing Biteer, provide global services Bitcoin mining can be an interesting experience, but sadly it seems that small at home hobbyists are being outcompeted by large mining farms. Two major issues facing those wishing to mine at home is the cost of electricity and getting equipment in on time. Many of the large farms make their own equipment, which gives them another advantage because purchases from ASIC (application specific integrated circuit) producers typically have long lead times. These ASICS are computers that do one thing and one thing only: run the hash algorithm. Mining today is dominated by these ASICS. Speed is shown in "hashes per second." Many miners today generally operate in the terahash range, with large farms operating in the petahash range. For comparison, the speed of the entire bitcoin network at the time of writing was 413.916 petahashes. You can see a more current chart here. The total mining speed of the network influences the difficulty of the blocks every 14 days. The network attempts to compensate for the amount of processing power bitcoin has access to by making it harder or easier, trying to keep the average time to find a block at about 10 minutes. So as the global bitcoin hashing power increases, the difficulty increases, which means earnings for the same hashing power generally decline over time. About every 10 minutes a new block is sent out into the network, and the entire network enters what is essentially a big lottery. Mining pools were created to make payouts more predictable. Miners combine their hashing power under a pool, which has enough hashing power to win the lottery on a more consistent basis than mining alone. A pool that has 15% of the networks hashing power should win 15% of the time. The pool then divides up the earnings from the block among individual miners based on their contribution, and there are many different ways to do this. Click here for more information on different payout systems. Most methods are pretty fair, and in the long run all pools will theoretically pay out about the same to you if given enough time. The things to look out for are fees and whether or not they pay transaction fees. Transaction fees vary by block, and are the culmination of all of the fees that took place when that block was created. Personally, I would place much more emphasis on the pool fee when choosing. However, be aware that not all pools are trustworthy. For example, I used Ghash.io for some time and for some reason the payouts didn't seem to compare to other pools I had used. I've never had any issues with Slush's pool or Antpool, and the average payout per day is what it should be. We offer the purchase of Bitcoin hashrate, you can buy according to their own circumstances, the higher the hashrate, the faster the speed of bitcoin mining (such as 1000GHS required investment funds is 0.01bit coins, Bitcoin exploitation rate is 0.0001BTC / day or so.) Our daily dividend payment, in GMT AM9: 00-AM10: 00 paid by the system unified, members don’t need to manually withdrawals, according to the daily bitcoin mining difficulty, the daily range of income will be in the 1.0% -1.2%. When we receive the member's Bitcoin (usually 1-3 hours, no more than 24 hours), members will have the corresponding hashrate, the higher the hashrate, bitcoin mining faster (such as 1000GHS The required investment capital is 0.01 bitcoin, Bitcoin mining speed is 0.0001BTC / day or so.) The real bitcoin mining is not so high income, in the real bitcoin mining, our earnings are the highest. We are not a rob Peter to pay Paul game, this is a real Bitcoin mining investment plan. Of course. For us, more people can join us to buy better and more advanced Bitcoin mining equipment, so we welcome more people to join. As a member, when you recommend a new member to join, you will get 8% of the amount purchased by the member as a referral bonus. We are the real Bitcoin mining company, we will always update Bitcoin mining data, and according to mining difficulty, to the members of the dividend, the daily earnings range is 1.0% -1.2%. Biteer is a global cloud mining program, everyone can participate in our mining plan, which also means that more people to join, can make our mining efficiency greatly improved. In order to allow more people to participate in our cloud mining program, we offer a high referral bonus. Our referral bonus is 8%.
Biteerprovide global services bitcoin miningglobal bitcoin hashing power increasesreal bitcoin mining investment planapplication specific integrated circuitmining efficiency greatly improvedglobal cloud mining programbitcon cloud mining companyhashing power generally declineupdate bitcoin mining dataadvanced bitcoin mining technologyminers today generally operatereal bitcoin mining companycloud bitcoin world conferenceghs required investment fundsadvanced bitcoin mining equipmentdaily bitcoin mining difficultyprivate mining servicescloud mining programreal bitcoin miningrequired investment capitalsuper cloud miningnetworks hashing powerprocessing power bitcoinbitcoin mining companiesbitcoin mining platformslarge mining farmsprivate mining cooperationbitcoin exploitation ratelarge farms operatingindividual miners basedpay paul gamemade electric energylong lead timesentire bitcoin networkentire network entersbitcoin mining fasterlarge farms maketransaction fees varymajor issues facingprivate mine ownersdaily dividend paymentbitcoin mining speedtotal mining speedpay transaction feescurrent chart members don&rsquohigh referral bonusdaily earnings rangemining planhashing powerinvestment fundsmining bitcoinbitcoin miningmining todaydifficulty increasescloud computingmining difficultydaily rangeinitial investmentbitcoin addressminers combineprovide investorstheoretically payenergy technologiesreferral bonusmining poolsbitcoin hashratepetahash rangeterahash rangenetwork attemptsnetwork influencespayout systemseffective solutionpretty fairlong runbit coinsbiteer&rsquomake paymentsrob peter4 baldwin foundedsystem unifiedhigh incomeimprove yield6 officially landedpayouts didnautomatically withdrawinteresting experiencerevenue sharinghash algorithmsingapore hostedconsistent basisrevenue lowermailbox authenticationmanually withdrawalsprofit modelmake payoutsgood returnsaverage payoutproducers typicallyput membersminimum amountamount purchasedbig lotterybiteer studioinvesting biteerbiteer limitedhome hobbyistsbtc / dayclick outcompeted pool feeaverage timemeans earningsminingbitcoinghsdifficultynetworkworldissuesdividendfasterfeesmakeminespeedequipmentmembersdayamount5 btcearningsbiteerhome: runincomemeanslotteryinvestorshashratepools pooltime

Domain Information
#Whois
Host : biteer.biz
Registrar : NEULEVEL

Nameservers :
vera.ns.cloudflare.com (173.245.58.147)
graham.ns.cloudflare.com (173.245.59.171)

Created :2016-12-04
Expires :2018-12-03
Updated :2017-01-18

Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP X2hour
19 hours ago
0.1
New HYIP Comexbit.com
22 hours ago
3.1
New HYIP Cocopay
1 day ago
0.1
New HYIP Waxhour
22 Apr 2025
0.1
New HYIP Infinityprofits
22 Apr 2025
2.0
New HYIP Empirerun
22 Apr 2025
1.8
New HYIP Ramonainv
22 Apr 2025
1.4
Latest Events
Recent event
Yaccuura
Sqmonitor 2 hours ago
changed | waiting » paying
Recent event
Ton-Bitcoin.com
Hyipclub 5 hours ago
changed | paying » not paid
Recent event
Zenpay
Tradinghyips 5 hours ago
removed | paying
Recent event
Asuhour
Ishprash 5 hours ago
removed | paying
Recent event
Bitmote Limited
Hothyips 5 hours ago
removed | paying
Recent event
Stable Grow
Sqmonitor 13 hours ago
changed | paying » waiting
Recent event
Aitimart
Hyipclub 15 hours ago
changed | paying » waiting
Problematic HYIP & Scam
Zenpay
Closed: 5 hours ago
Asuhour
Closed: 5 hours ago
Cwopaid
Closed: 1 day ago
Vanguard Analytics Ltd
Closed: 1 day ago
Assets Aliged
Closed: 1 day ago
Baxhour
Closed: 23 Apr 2025
Zmxpaid
Closed: 22 Apr 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback