Check out HYIPs with HYIP.biz
Reviews+29 | Payouts |  Blacklist |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 23 Apr 2025 00:54:51
Last Update: 23 Apr 2025 00:00:02
 
Join with: 
 
Biflow
0.0
Biflow
+
Added: Jun 06,2024 12:55
Closed: Jun 16,2024 [10 days]
Payment systems:
Features:
ddos protection
Waiting1
Not Paying1
Plans: 1.5% daily for 10 days, 1.87% daily for 15 days, 2.37% daily...
Min deposit: $1
Max deposit: $∞
Referral: 2 Levels: 6%-3%
Withdrawal: Instant
Total deposited: $6,511 750 views [32 clicks] Reviews: 000
Forum(s): DTMDMTMM4MMGPPF1
Telegram(s): @Sebastian_support @biflow_news

«Biflow» summary

This «RiskRank» metric is a general litmus test for the quality of the «Biflow» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of biflow.org and the results from 0 to 10 points.

biflow.org good quality signs

  • IP address not used by other HYIPs;
  • Featured on a reputable HYIP monitoring platforms;

biflow.org poor signs

  • Free SSL without a confidence guarantee;
  • Extra cheap hosting. The server has too many websites that share server resourses.
  • A few texts are similar to other HYIPs;
0.0
This project is a scam and stops paying on Jun 16, 2024.
Warning! The "biflow.org" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/biflow-biflow-org.707587/
https://pf1.ru/topic64806.html
Domain: biflow.org is registered for a 1 year by CSL Computer Service Langenbach GmbH d/b/a joker.c
[from May 30,2024 to May 30,2025]
~
ssl Free SSL valid for a 2 months - Google Trust Services LLC
-
Shared Hosting  Cheap price hosting - 522 domains hosted on IP: 104.21.6.28
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] -
IP: 104.21.6.28 [not used in other projects]
Network: 104.16.x.x [5926 projects] United States
+
Found similar content [text: 92 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "biflow.org"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 8
not paid
21 Jun 2024
$1000 49%
490 USD
15 Jun 2024
10 months ago
paying » not paid
10 months ago
06 Jun 2024
10 months ago
+ CfcMonitor *warn 15
waiting
16 Jun 2024
$300 -
-
added with: waiting
10 months ago
12 Jun 2024
10 months ago
RCB Deposit Flow
 
15 Jun 2024
RCB
$700.00
$74.42
3 deposits
min: $150 max: $300 avg: $234
14 Jun 2024
RCB
$380.00
$37.50
3 deposits
min: $50 max: $200 avg: $127
13 Jun 2024
RCB
$1,250.00
$137.41
4 deposits
min: $200 max: $400 avg: $313
12 Jun 2024
RCB
$403.00
$51.36
2 deposits
min: $53 max: $350 avg: $202
11 Jun 2024
RCB
$790.00
$105.14
4 deposits
min: $40 max: $400 avg: $198
10 Jun 2024
RCB
$50.00
$7.98
1 deposit
09 Jun 2024
RCB
$250.00
$44.89
2 deposits
min: $100 max: $150 avg: $125
08 Jun 2024
RCB
$668.00
$95.93
3 deposits
min: $48 max: $500 avg: $223
07 Jun 2024
RCB
$360.00
$55.85
6 deposits
min: $30 max: $100 avg: $60
06 Jun 2024
RCB
$1,260.00
$192.00
13 deposits
min: $30 max: $250 avg: $97
Summary of Deposits
updated: Jun 16,2024 18:00:03
InvesTracing
RCB
$6,111.00
$802.48
41 deposits
min: $30 max: $500 avg: $150

Content
#Tags

Here's what it says on the biflow.org website:

discover decentralized cloud mining Earn up to 2.37% daily thanks to the reliable operation of our equipment located in Spain, where the cost of electricity is available at a good price, making mining accessible and profit high. affilIate program Biflow Affiliate program offers lucrative benefits for our loyal users. Designed with two levels, it ensures generous rewards (up to 6% from your friend's deposit) for inviting new users. Invite friends - earn more together! Invite new users to become your first-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 6% of their deposit amount. Earn an additional 3% reward on the deposit amount of second-level referrals. Invite new users to become your second and third-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 7% of their deposit amount. Earn an additional 2% reward on the deposit amount of 2 and 3 -level referrals. Invite new users to become your referrals. When they join and make a minimum deposit, you'll earn a guaranteed 9% of their deposit amount. Earn an additional 3% reward on the deposit amount of 2 and 2% of 3 -level referrals. Explore our top mining and staking platform, driven by the powerful Bitmain Antminer L7 8800 M (8.8Gh) ASIC miners. T hese machines are super efficient, reliable, and strong, making them the best in cryptocurrency mining tech. You can easily start mining crypto without setting up or maintaining your own hardware. Find “Profit Calculator” on the Home page -> select the currency, investment amount, and the number of days you want to calculate your profit - > receive the ready result on your screen immediately! Sign up on the Biflow platform by entering your email -> log in to your account -> deposit crypto to buy more hashing power or allocate existing one among available currencies in % ratio -> after that you start earning instantly. Log in to your account on the platform -> find “Deposit” page ->. select the currency -> click “Generate Address” -> transfer any amount of funds to that wallet address. Log in -> go to the “Withdraw” page -> select the currency you want to withdraw -> enter your withdrawal amount. Double-check all the entered data and click the “Withdraw Funds” button. Absolutely! Our program has 2 levels and offers up to 6% rewards for inviting new users. After your friends (1st-level referrals) purchase the hashing power, you’ll get 6% from their deposit in the deposited currency. If their friends (2nd-level referrals) purchase hashing power, you’ll get 3% from their deposit in the deposited currency. Withdraw your profit without any limits, anytime you need. If you do not receive an email in your inbox, please check your spam folder.
Biflowbiflow affiliate program offers lucrative benefitspowerful bitmain antminer l7easily start mining cryptostart earning instantlycryptocurrency mining techstart cloud miningensures generous rewardswithdrawal account balancemaking mining accessiblegenerate address&rdquobiflow platform supportminimum withdrawal amountprofit calculator&rdquoaffiliate programpurchase hashing powerminimum deposit amountwithdraw funds&rdquocloud miningwithdrawal amountdeposit cryptohashing powertop miningactivate miningbiflow platformminimum depositwallet addresswithdraw&rdquodeposit&rdquoinvestment amountspam folderstaking platformmobile applicationasic minerssuper efficientready resultallocate existingentered datahese machinesscreen immediatelyequipment locatedgood pricedeposit amountwithdraw fundsprofit highlevel referralsemail addresshome pagefind &ldquologin pagereliable operationoffersdeposited currencydaily profitloyal usersprogramll earnclick &ldquoinvite friendsbiflow&rdquoamountplatformmaking6% rewardsfundsaccountpurchasereferralswithdrawprofitleveldepositllreliablepage&ldquo7% dailycurrencyfriendsemailclickearninviteusers

Domain Information
#Whois
Host : biflow.org
Registrar : CSL Computer Service Langenbach GmbH d/b/a joker.c

Nameservers :
duke.ns.cloudflare.com (173.245.59.110)
frida.ns.cloudflare.com (162.159.38.137)

Created :2024-05-30
Expires :2025-05-30
Updated :2024-04-06

Monitoring
New HYIP King Hectares
Invested: $150
paying
New HYIP Assets Aliged
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Waxhour
9 hours ago
0.1
New HYIP Infinityprofits
10 hours ago
2.0
New HYIP Empirerun
17 hours ago
1.8
New HYIP Ramonainv
23 hours ago
1.4
New HYIP Zenpay
1 day ago
0.1
New HYIP Punk Monkey Usd
1 day ago
2.6
New HYIP Alniri
20 Apr 2025
4.4
Latest Events
Recent event
Waxhour
Tradinghyips 9 hours ago
added | paying
Recent event
Waxhour
Ishprash 9 hours ago
added | paying
Recent event
Luxio Profit Limited
Sqmonitor 9 hours ago
changed | paying » waiting
Recent event
Infinityprofits
Sqmonitor 10 hours ago
added | paying
Recent event
Invest-Fond.net
Instantmonitor 14 hours ago
added | waiting
Recent event
Nextera Financial
Instantmonitor 14 hours ago
changed | waiting » paying
Recent event
Punk Monkey Usd
Investracing 16 hours ago
changed | waiting » paying
Problematic HYIP & Scam
Zmxpaid
Closed: 19 hours ago
Dnx Group
Closed: 1 day ago
Goldenlion.biz
Closed: 1 day ago
Mixhour
Closed: 20 Apr 2025
Goldpaid
Closed: 19 Apr 2025
Pavhour
Closed: 19 Apr 2025
Prime Bridge Ltd
Closed: 19 Apr 2025
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback