Server Time: 27 Mar 2026 04:45:23
Last Update: 27 Mar 2026 04:00:03
Telegram
 
Join with: 
Biflow
Reviews: 000
[1316 views]
[35 clicks]
Biflow
Added: Jun 06,2024 12:55
Closed: Jun 16,2024 [10 days]
Waiting1
Not Paying1
Payment systems:
Features:
DDOS protection
Plans: 1.5% daily for 10 days, 1.87% daily for 15 days, 2.37% daily for 28 days (Principal Return)
Min deposit: $1 Max deposit: $∞
Referral: 2 Levels: 6%-3%
Withdrawal: Instant
X
This project is a scam and stopped paying on Jun 16, 2024.
Total deposited: $6,511
Forum(s): DTMDMTMM4MMGPPF1
Telegram(s): @Sebastian_support @biflow_news

«Biflow» [biflow.org] Summary

The «RiskRank» metric serves as a comprehensive indicator of the overall quality of the «Biflow», evaluated based on multiple criteria. Below is a detailed analysis of biflow.org, with a score ranging from 0 to 10 points.

Green flags:

  • Plans: 2/3 flagged green;
  • IP address not used by other HYIPs;
  • Featured on a reputable monitoring platforms;

Red flags:

  • Free SSL: A basic security certificate provided free of charge for a short period to encrypt data on a website;
  • High-density hosting: Many websites share this IP, increasing the risk of slow performance during peak loads;
Warning! The "biflow.org" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/biflow-biflow-org.707587/
https://pf1.ru/topic64806.html
Domain: biflow.org is registered for a 1 year by CSL Computer Service Langenbach GmbH d/b/a joker.c
[from May 30,2024 to May 30,2025]
~
ssl Free SSL valid for a 2 months - Google Trust Services LLC
-
Shared Hosting  Server - IP address 104.21.6.28 hosts 522 domains
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] -
IP: 104.21.6.28 [not used in other projects]
Network: 104.16.x.x [6022 projects] United States
+
Found similar content [text: 92 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "biflow.org"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 8
not paid
21 Jun 2024
$1000 49%
490 USD
15 Jun 2024
1 year ago
paying » not paid
1 year ago
06 Jun 2024
1 year ago
+ CfcMonitor *warn 15
waiting
16 Jun 2024
$300 -
-
added with: waiting
1 year ago
12 Jun 2024
1 year ago
RCB Deposit Flow
 
15 Jun 2024
RCB
$700.00
$74.42
3 deposits
min: $150 max: $300 avg: $234
14 Jun 2024
RCB
$380.00
$37.50
3 deposits
min: $50 max: $200 avg: $127
13 Jun 2024
RCB
$1,250.00
$137.41
4 deposits
min: $200 max: $400 avg: $313
12 Jun 2024
RCB
$403.00
$51.36
2 deposits
min: $53 max: $350 avg: $202
11 Jun 2024
RCB
$790.00
$105.14
4 deposits
min: $40 max: $400 avg: $198
10 Jun 2024
RCB
$50.00
$7.98
1 deposit
09 Jun 2024
RCB
$250.00
$44.89
2 deposits
min: $100 max: $150 avg: $125
08 Jun 2024
RCB
$668.00
$95.93
3 deposits
min: $48 max: $500 avg: $223
07 Jun 2024
RCB
$360.00
$55.85
6 deposits
min: $30 max: $100 avg: $60
06 Jun 2024
RCB
$1,260.00
$192.00
13 deposits
min: $30 max: $250 avg: $97
Summary of Deposits
updated: Jun 16,2024 18:00:03
InvesTracing
RCB
$6,111.00
$802.48
41 deposits
min: $30 max: $500 avg: $150

Content
#Tags

Here's what it says on the biflow.org website:

discover decentralized cloud mining Earn up to 2.37% daily thanks to the reliable operation of our equipment located in Spain, where the cost of electricity is available at a good price, making mining accessible and profit high. affilIate program Biflow Affiliate program offers lucrative benefits for our loyal users. Designed with two levels, it ensures generous rewards (up to 6% from your friend's deposit) for inviting new users. Invite friends - earn more together! Invite new users to become your first-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 6% of their deposit amount. Earn an additional 3% reward on the deposit amount of second-level referrals. Invite new users to become your second and third-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 7% of their deposit amount. Earn an additional 2% reward on the deposit amount of 2 and 3 -level referrals. Invite new users to become your referrals. When they join and make a minimum deposit, you'll earn a guaranteed 9% of their deposit amount. Earn an additional 3% reward on the deposit amount of 2 and 2% of 3 -level referrals. Explore our top mining and staking platform, driven by the powerful Bitmain Antminer L7 8800 M (8.8Gh) ASIC miners. T hese machines are super efficient, reliable, and strong, making them the best in cryptocurrency mining tech. You can easily start mining crypto without setting up or maintaining your own hardware. Find “Profit Calculator” on the Home page -> select the currency, investment amount, and the number of days you want to calculate your profit - > receive the ready result on your screen immediately! Sign up on the Biflow platform by entering your email -> log in to your account -> deposit crypto to buy more hashing power or allocate existing one among available currencies in % ratio -> after that you start earning instantly. Log in to your account on the platform -> find “Deposit” page ->. select the currency -> click “Generate Address” -> transfer any amount of funds to that wallet address. Log in -> go to the “Withdraw” page -> select the currency you want to withdraw -> enter your withdrawal amount. Double-check all the entered data and click the “Withdraw Funds” button. Absolutely! Our program has 2 levels and offers up to 6% rewards for inviting new users. After your friends (1st-level referrals) purchase the hashing power, you’ll get 6% from their deposit in the deposited currency. If their friends (2nd-level referrals) purchase hashing power, you’ll get 3% from their deposit in the deposited currency. Withdraw your profit without any limits, anytime you need. If you do not receive an email in your inbox, please check your spam folder.
Biflowbiflow affiliate program offers lucrative benefitspowerful bitmain antminer l7easily start mining cryptostart earning instantlycryptocurrency mining techstart cloud miningensures generous rewardswithdrawal account balancemaking mining accessiblegenerate address&rdquobiflow platform supportminimum withdrawal amountprofit calculator&rdquoaffiliate programpurchase hashing powerminimum deposit amountwithdraw funds&rdquocloud miningwithdrawal amountdeposit cryptohashing powertop miningactivate miningbiflow platformminimum depositwallet addresswithdraw&rdquodeposit&rdquoinvestment amountspam folderstaking platformmobile applicationasic minerssuper efficientready resultallocate existingentered datahese machinesscreen immediatelyequipment locatedgood pricedeposit amountwithdraw fundsprofit highlevel referralsemail addresshome pagefind &ldquologin pagereliable operationoffersdeposited currencydaily profitloyal usersprogramll earnclick &ldquoinvite friendsbiflow&rdquoamountplatformmaking6% rewardsfundsaccountpurchasereferralswithdrawprofitleveldepositllreliablepage&ldquo7% dailycurrencyfriendsemailclickearninviteusers

Domain Information
#Whois
Host : biflow.org
Registrar : CSL Computer Service Langenbach GmbH d/b/a joker.c

Nameservers :
duke.ns.cloudflare.com (173.245.59.110)
frida.ns.cloudflare.com (162.159.38.137)

Created :2024-05-30
Expires :2025-05-30
Updated :2024-04-06

Monitoring
New HYIP Winvest
Invested: $250
paying
New HYIP Lajaprofit
Invested: $200
paying
New HYIP King Hectares
Invested: $150
paying
New HYIPs
New HYIP Green Core
9 hours ago
0.1
New HYIP Netoninvest
17 hours ago
1.7
New HYIP Divine Empire Beauty
1 day ago
0.3
New HYIP Bitcare
1 day ago
0.6
New HYIP Xolo.network
24 Mar 2026
1.4
New HYIP Ledgerax
23 Mar 2026
0.6
New HYIP Gain10
23 Mar 2026
1.1
Latest Events
Recent event
Green Core
Sqmonitor 9 hours ago
added | paying
Recent event
Netoninvest
Sqmonitor 9 hours ago
added | paying
Recent event
Qchartist Investment
Hothyips 12 hours ago
changed | paying » not paid
Recent event
Foxvanta
Richinvestmonitor 14 hours ago
added | waiting
Recent event
Circuito Venture
Sqmonitor 16 hours ago
changed | waiting » problem
Recent event
Netoninvest
Hyipexplorer 17 hours ago
added | waiting
Recent event
Mevprimebot
Instantmonitor 20 hours ago
changed | paying » not paid
Problematic HYIP & Scam
Circuito Venture
Closed: 16 hours ago
Mevprimebot
Closed: 20 hours ago
Wexon
Closed: 24 Mar 2026
Amerona
Closed: 24 Mar 2026
Morela
Closed: 23 Mar 2026
Fast Burger
Closed: 15 Mar 2026
Invest Dex Limited
Closed: 13 Mar 2026
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
Advertising |  Add Project  What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback