Check out HYIPs with HYIP.biz
Reviews+6 | Payouts+27 |  Blacklist+1 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 23 Jun 2024 10:19:43
Last Update: 23 Jun 2024 10:00:03
 
Join with: 
 
Biflow
0.0
Biflow
+
Added: Jun 06,2024 12:55
Closed: Jun 16,2024 [10 days]
Payment systems:
Features:
ddos protection
Waiting1
Not Paying1
Plans: 1.5% daily for 10 days, 1.87% daily for 15 days, 2.37% daily...
Min deposit: $1
Max deposit: $∞
Referral: 2 Levels: 6%-3%
Withdrawal: Instant
Total deposited: $6,511 234 views [15 clicks] Reviews: 000
Warning! The "biflow.org" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/biflow-biflow-org.707587/
Domain: biflow.org is registered for a 1 year by CSL Computer Service Langenbach GmbH d/b/a joker.c
[from May 30,2024 to May 30,2025]
~
ssl Free SSL valid for a 2 months - Google Trust Services LLC
-
Shared Hosting  Cheap price hosting - 522 domains hosted on IP: 104.21.6.28
-
Hosting: Cloudflare, Inc. [ cloudflare.com ] -
IP: 104.21.6.28 [not used in other projects]
Network: 104.16.x.x [5697 projects] United States
+
Found similar content [text: 92 projects]
-

Similarities of biflow.org based on statistic researching

Here are closed projects with similar payouts plans as 1.5% daily for 10 days, 1.87% daily... and included other metrics;
that's stopped pay after min: 6 max: 77 avg: 24 days from a project start date.
Found [554 projects] with proximate payouts plans in total.

Latest Reviews
Be first to add a vote/review and share your statement about "biflow.org"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 8
not paid
21 Jun 2024
$1000 49%
490 USD
15 Jun 2024
1 week ago
paying » not paid
6 days ago
06 Jun 2024
2 weeks ago
+ CfcMonitor *warn 15
waiting
16 Jun 2024
$300 -
-
added with: waiting
1 week ago
12 Jun 2024
1 week ago
RCB Deposit Flow
 
15 Jun 2024
RCB
$700.00
$74.42
3 deposits
min: $150 max: $300 avg: $234
14 Jun 2024
RCB
$380.00
$37.50
3 deposits
min: $50 max: $200 avg: $127
13 Jun 2024
RCB
$1,250.00
$137.41
4 deposits
min: $200 max: $400 avg: $313
12 Jun 2024
RCB
$403.00
$51.36
2 deposits
min: $53 max: $350 avg: $202
11 Jun 2024
RCB
$790.00
$105.14
4 deposits
min: $40 max: $400 avg: $198
10 Jun 2024
RCB
$50.00
$7.98
1 deposit
09 Jun 2024
RCB
$250.00
$44.89
2 deposits
min: $100 max: $150 avg: $125
08 Jun 2024
RCB
$668.00
$95.93
3 deposits
min: $48 max: $500 avg: $223
07 Jun 2024
RCB
$360.00
$55.85
6 deposits
min: $30 max: $100 avg: $60
06 Jun 2024
RCB
$1,260.00
$192.00
13 deposits
min: $30 max: $250 avg: $97
Summary of Deposits
updated: Jun 16,2024 18:00:03
InvesTracing
RCB
$6,111.00
$802.48
41 deposits
min: $30 max: $500 avg: $150

Content
#Tags

Here's what it says on the biflow.org website:

discover decentralized cloud mining Earn up to 2.37% daily thanks to the reliable operation of our equipment located in Spain, where the cost of electricity is available at a good price, making mining accessible and profit high. affilIate program Biflow Affiliate program offers lucrative benefits for our loyal users. Designed with two levels, it ensures generous rewards (up to 6% from your friend's deposit) for inviting new users. Invite friends - earn more together! Invite new users to become your first-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 6% of their deposit amount. Earn an additional 3% reward on the deposit amount of second-level referrals. Invite new users to become your second and third-level referrals. When they join and make a minimum deposit, you'll earn a guaranteed 7% of their deposit amount. Earn an additional 2% reward on the deposit amount of 2 and 3 -level referrals. Invite new users to become your referrals. When they join and make a minimum deposit, you'll earn a guaranteed 9% of their deposit amount. Earn an additional 3% reward on the deposit amount of 2 and 2% of 3 -level referrals. Explore our top mining and staking platform, driven by the powerful Bitmain Antminer L7 8800 M (8.8Gh) ASIC miners. T hese machines are super efficient, reliable, and strong, making them the best in cryptocurrency mining tech. You can easily start mining crypto without setting up or maintaining your own hardware. Find “Profit Calculator” on the Home page -> select the currency, investment amount, and the number of days you want to calculate your profit - > receive the ready result on your screen immediately! Sign up on the Biflow platform by entering your email -> log in to your account -> deposit crypto to buy more hashing power or allocate existing one among available currencies in % ratio -> after that you start earning instantly. Log in to your account on the platform -> find “Deposit” page ->. select the currency -> click “Generate Address” -> transfer any amount of funds to that wallet address. Log in -> go to the “Withdraw” page -> select the currency you want to withdraw -> enter your withdrawal amount. Double-check all the entered data and click the “Withdraw Funds” button. Absolutely! Our program has 2 levels and offers up to 6% rewards for inviting new users. After your friends (1st-level referrals) purchase the hashing power, you’ll get 6% from their deposit in the deposited currency. If their friends (2nd-level referrals) purchase hashing power, you’ll get 3% from their deposit in the deposited currency. Withdraw your profit without any limits, anytime you need. If you do not receive an email in your inbox, please check your spam folder.
Biflowbiflow affiliate program offers lucrative benefitspowerful bitmain antminer l7easily start mining cryptostart earning instantlycryptocurrency mining techstart cloud miningensures generous rewardswithdrawal account balancemaking mining accessiblegenerate address&rdquobiflow platform supportminimum withdrawal amountprofit calculator&rdquoaffiliate programpurchase hashing powerminimum deposit amountwithdraw funds&rdquocloud miningwithdrawal amountdeposit cryptohashing powertop miningactivate miningbiflow platformminimum depositwallet addresswithdraw&rdquodeposit&rdquoinvestment amountspam folderstaking platformmobile applicationasic minerssuper efficientready resultallocate existingentered datahese machinesscreen immediatelyequipment locatedgood pricedeposit amountwithdraw fundsprofit highlevel referralsemail addresshome pagefind &ldquologin pagereliable operationoffersdeposited currencydaily profitloyal usersprogramll earnclick &ldquoinvite friendsbiflow&rdquoamountplatformmaking6% rewardsfundsaccountpurchasereferralswithdrawprofitleveldepositllreliablepage&ldquo7% dailycurrencyfriendsemailclickearninviteusers

Domain Information
#Whois
Host : biflow.org
Registrar : CSL Computer Service Langenbach GmbH d/b/a joker.c

Nameservers :
duke.ns.cloudflare.com (173.245.59.110)
frida.ns.cloudflare.com (162.159.38.137)

Created :2024-05-30
Expires :2025-05-30
Updated :2024-04-06

Monitoring
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIPs
New HYIP Gain-Hour
1 day ago
0.1
New HYIP Liqfarm.com
1 day ago
4.9
New HYIP Moxa-Forex
1 day ago
0.1
New HYIP Achieversfinance
21 Jun 2024
0.8
New HYIP Build-Hour
20 Jun 2024
0.1
New HYIP Xeroox.com
19 Jun 2024
0.8
New HYIP Gold2024
19 Jun 2024
0.1
Latest Events
Recent event
Beck Assets
List4hyip 3 hours ago
added | paying
Recent event
Azm-Forex
Ishprash 5 hours ago
removed | paying
Recent event
Valor Vest
Investracing 5 hours ago
changed | problem » not paid
Recent event
Achieversfinance
Hyipexplorer 8 hours ago
added | waiting
Recent event
Buddybets.club
Instantmonitor 13 hours ago
changed | waiting » paying
Recent event
Gain-Hour
Tradinghyips 16 hours ago
added | paying
Recent event
Сoinsuper.biz
Instantmonitor 18 hours ago
changed | waiting » paying
Problematic HYIP & Scam
Azm-Forex
Closed: 5 hours ago
Meza Trade
Closed: 1 day ago
Metal Crypto
Closed: 1 day ago
Quant Guard
Closed: 1 day ago
Valor Vest
Closed: 21 Jun 2024
Best-Token
Closed: 20 Jun 2024
Conspro
Closed: 19 Jun 2024
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback