|
|
Biflow
Added: Jun 06,2024 12:55
Closed: Jun 16,2024 [10 days]
|
|
Features:

|
|
|
Plans: 1.5% daily for 10 days, 1.87% daily for 15 days, 2.37% daily...
Min deposit: $1
Max deposit: $∞
Referral: 2 Levels: 6%-3%
Withdrawal: Instant
|
Total deposited: $6,511
|
755 views [32 clicks]
Reviews: 000
|
«Biflow» summaryThis «RiskRank» metric is a general litmus test for the quality of the «Biflow» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of biflow.org and the results from 0 to 10 points.
biflow.org good quality signs:
- IP address not used by other HYIPs;
- Featured on a reputable HYIP monitoring platforms;
biflow.org red flags:
- Free SSL without a confidence guarantee;
- Extra cheap hosting. The server has too many websites that share server resourses.
- A few texts are similar to other HYIPs;
|
This project is a scam and stops paying on Jun 16, 2024.
|
Warning! The "biflow.org" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/biflow-biflow-org.707587/ https://pf1.ru/topic64806.html
|
Domain: |
biflow.org is registered for a 1 year
by CSL Computer Service Langenbach GmbH d/b/a joker.c [from May 30,2024 to May 30,2025]
|
|
~ |
Free SSL
valid for a 2 months - Google Trust Services LLC
|
- |
Cheap price hosting
- 522 domains hosted on IP: 104.21.6.28
|
- |
Hosting: Cloudflare, Inc. [ cloudflare.com ]
|
- |
IP: 104.21.6.28 [not used in other projects]
Network: 104.16.x.x [5927 projects]
 |
+ |
|
- |
|
# |
Monitor |
#Pos. |
Status Updated |
Invested |
ROI(%) USD |
Last Payout |
Latest Event |
Added |
|
InvesTracing
|
8 |
not paid
21 Jun 2024
|
$1000 |
49%
490 USD |
|
paying »
not paid10 months ago
|
06 Jun 2024
10 months ago
|
|
CfcMonitor
*warn |
15 |
waiting
16 Jun 2024
|
$300 |
- |
-
|
added with:
waiting10 months ago
|
12 Jun 2024
10 months ago
|
15 Jun 2024 RCB |
$700.00 $74.42 |
3 deposits
min: $150
max: $300
avg: $234
|
 |
InvesTracing RCB |
$700.00 $74.42 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
15:23:26 |
lu* |
$150 / $17.66 |
waiting |
11:08:45 |
er* |
$300 / $30.83 |
waiting |
02:21:38 |
ko* |
$250 / $25.93 |
waiting |
14 Jun 2024 RCB |
$380.00 $37.50 |
3 deposits
min: $50
max: $200
avg: $127
|
 |
InvesTracing RCB |
$380.00 $37.50 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
23:47:05 |
ro* |
$50 / $4.6 |
paid |
13:04:45 |
li* |
$130 / $14.1 |
waiting |
08:15:17 |
Pa* |
$200 / $18.8 |
paid |
13 Jun 2024 RCB |
$1,250.00 $137.41 |
4 deposits
min: $200
max: $400
avg: $313
|
 |
InvesTracing RCB |
$1,250.00 $137.41 |
4 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
18:35:09 |
Bi* |
$400 / $50.02 |
paid |
18:35:09 |
Bi* |
$400 / $25 |
waiting |
13:19:32 |
vo* |
$250 / $32.77 |
paid |
10:55:53 |
Ta* |
$200 / $29.62 |
paid |
07:21:29 |
Bi* |
$400 / $50.02 |
suspended |
12 Jun 2024 RCB |
$403.00 $51.36 |
2 deposits
min: $53
max: $350
avg: $202
|
 |
InvesTracing RCB |
$403.00 $51.36 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
12:01:57 |
ma* |
$350 / $43.02 |
paid |
08:02:01 |
yn* |
$53 / $8.34 |
paid |
11 Jun 2024 RCB |
$790.00 $105.14 |
4 deposits
min: $40
max: $400
avg: $198
|
 |
InvesTracing RCB |
$790.00 $105.14 |
4 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
21:43:48 |
mo* |
$400 / $50.02 |
paid |
16:53:55 |
Nk* |
$40 / $6.2 |
paid |
14:10:49 |
kl* |
$50 / $8 |
paid |
09:53:37 |
al* |
$300 / $40.92 |
paid |
10 Jun 2024 RCB |
$50.00 $7.98 |
1 deposit
|
 |
InvesTracing RCB |
$50.00 $7.98 |
1 deposit |
 |
Time |
User |
Deposit / RCB |
Status |
11:07:32 |
mo* |
$50 / $7.98 |
paid |
09 Jun 2024 RCB |
$250.00 $44.89 |
2 deposits
min: $100
max: $150
avg: $125
|
 |
InvesTracing RCB |
$250.00 $44.89 |
2 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
18:57:56 |
sw* |
$150 / $24.17 |
paid |
10:55:54 |
mo* |
$100 / $20.72 |
paid |
08 Jun 2024 RCB |
$668.00 $95.93 |
3 deposits
min: $48
max: $500
avg: $223
|
 |
InvesTracing RCB |
$668.00 $95.93 |
3 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
20:09:54 |
ad* |
$48 / $7.11 |
paid |
18:34:48 |
al* |
$120 / $19.8 |
paid |
09:29:57 |
ma* |
$500 / $69.02 |
paid |
07 Jun 2024 RCB |
$360.00 $55.85 |
6 deposits
min: $30
max: $100
avg: $60
|
 |
InvesTracing RCB |
$360.00 $55.85 |
6 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
22:12:45 |
Ha* |
$50 / $7.58 |
paid |
13:09:26 |
HA* |
$100 / $16.02 |
paid |
06:03:00 |
Ma* |
$30 / $4.08 |
paid |
05:48:28 |
Ad* |
$100 / $16.32 |
paid |
05:44:37 |
my* |
$30 / $4.1 |
paid |
02:09:20 |
sa* |
$50 / $7.75 |
paid |
06 Jun 2024 RCB |
$1,260.00 $192.00 |
13 deposits
min: $30
max: $250
avg: $97
|
 |
InvesTracing RCB |
$1,260.00 $192.00 |
13 deposits |
 |
Time |
User |
Deposit / RCB |
Status |
23:45:54 |
je* |
$80 / $12.94 |
paid |
22:35:34 |
ba* |
$100 / $16.02 |
paid |
21:26:21 |
Ja* |
$100 / $16.02 |
paid |
16:28:54 |
ze* |
$70 / $11.01 |
paid |
15:49:44 |
ua* |
$50 / $7.75 |
paid |
14:44:15 |
ma* |
$200 / $27.62 |
paid |
14:35:52 |
ma* |
$100 / $16.32 |
paid |
14:31:27 |
yo* |
$100 / $16.32 |
paid |
14:28:46 |
Tr* |
$100 / $16.82 |
paid |
14:15:32 |
kr* |
$50 / $8.5 |
paid |
14:14:02 |
ch* |
$250 / $31.02 |
paid |
14:04:46 |
Al* |
$30 / $5.58 |
paid |
13:36:42 |
Mi* |
$30 / $6.08 |
paid |
|
Summary of Deposits updated: Jun 16,2024 18:00:03 |
InvesTracing
RCB
|
$6,111.00
$802.48
|
41 deposits
min: $30
max: $500
avg: $150
|
 |
Top 10 Deposits |
Users with multiple deposits: 7 |
Time |
User |
Deposit / RCB |
Status |
Jun 08,2024 09:29:57 |
ma*** |
$500 / $69.02 |
paid |
Jun 13,2024 18:35:09 |
Bi*** |
$400 / $50.02 |
paid |
Jun 11,2024 21:43:48 |
mo*** |
$400 / $50.02 |
paid |
Jun 13,2024 18:35:09 |
Bi*** |
$400 / $25 |
waiting |
Jun 12,2024 12:01:57 |
ma*** |
$350 / $43.02 |
paid |
Jun 11,2024 09:53:37 |
al*** |
$300 / $40.92 |
paid |
Jun 15,2024 11:08:45 |
er*** |
$300 / $30.83 |
waiting |
Jun 06,2024 14:14:02 |
ch*** |
$250 / $31.02 |
paid |
Jun 13,2024 13:19:32 |
vo*** |
$250 / $32.77 |
paid |
Jun 15,2024 02:21:38 |
ko*** |
$250 / $25.93 |
waiting |
|
Here's what it says on the biflow.org website:
discover
decentralized
cloud mining
Earn up to 2.37% daily thanks to the reliable operation of our equipment located in Spain, where the
cost of electricity is available at a good price, making mining accessible and profit high.
affilIate
program
Biflow Affiliate program offers lucrative benefits for
our loyal users.
Designed with two levels, it ensures generous rewards (up to 6%
from your friend's deposit) for inviting new users. Invite friends -
earn more together!
Invite new users to become your first-level
referrals. When they join and make a minimum deposit, you'll earn a
guaranteed 6% of their deposit amount. Earn an additional 3% reward on
the deposit amount of second-level referrals.
Invite new users to become your second and
third-level referrals. When they join and make a minimum deposit, you'll
earn a guaranteed 7% of their deposit amount. Earn an additional 2%
reward on the deposit amount of 2 and 3 -level referrals.
Invite new users to become your referrals.
When they join and make a minimum deposit, you'll earn a guaranteed 9%
of their deposit amount. Earn an additional 3% reward on the deposit
amount of 2 and 2% of 3 -level referrals.
Explore our top
mining and staking platform, driven by the powerful Bitmain Antminer L7
8800 M (8.8Gh) ASIC miners. T
hese machines are super efficient, reliable, and strong, making
them the best in cryptocurrency mining tech. You can easily start mining
crypto without setting up or maintaining your own hardware.
Find “Profit
Calculator” on the Home page -> select the currency, investment
amount, and the number of days you want to calculate your profit - >
receive the ready result on your screen immediately!
Sign up on the Biflow
platform by entering your email -> log in to your account ->
deposit crypto to buy more hashing power or allocate existing one
among available currencies in % ratio -> after that you start earning
instantly.
Log in to your
account on the platform -> find “Deposit” page ->. select the
currency -> click “Generate Address” -> transfer any amount of
funds to that wallet address.
Log in -> go to
the “Withdraw” page -> select the currency you want to withdraw ->
enter your withdrawal amount. Double-check all the entered data and click the “Withdraw
Funds” button.
Absolutely! Our
program has 2 levels and offers up to 6% rewards for inviting new users.
After your friends (1st-level referrals) purchase the hashing power,
you’ll get 6% from their deposit in the deposited currency.
If their friends (2nd-level referrals)
purchase hashing power, you’ll get 3% from their deposit in the
deposited currency. Withdraw your profit without any limits, anytime you
need. If you do not receive an email in your inbox,
please check your spam folder. biflow affiliate program offers lucrative benefitspowerful bitmain antminer l7easily start mining cryptostart earning instantlycryptocurrency mining techstart cloud miningensures generous rewardswithdrawal account balancemaking mining accessiblegenerate address&rdquobiflow platform supportminimum withdrawal amountprofit calculator&rdquoaffiliate programpurchase hashing powerminimum deposit amountwithdraw funds&rdquocloud miningwithdrawal amountdeposit cryptohashing powertop miningactivate miningbiflow platformminimum depositwallet addresswithdraw&rdquodeposit&rdquoinvestment amountspam folderstaking platformmobile applicationasic minerssuper efficientready resultallocate existingentered datahese machinesscreen immediatelyequipment locatedgood pricedeposit amountwithdraw fundsprofit highlevel referralsemail addresshome pagefind &ldquologin pagereliable operationoffersdeposited currencydaily profitloyal usersprogramll earnclick &ldquoinvite friendsbiflow&rdquoamountplatformmaking6% rewardsfundsaccountpurchasereferralswithdrawprofitleveldepositllreliablepage&ldquo7% dailycurrencyfriendsemailclickearninviteusers
|
Host : |
biflow.org |
Registrar : |
CSL Computer Service Langenbach GmbH d/b/a joker.c |
|
Nameservers : |
duke.ns.cloudflare.com (173.245.59.110)
frida.ns.cloudflare.com (162.159.38.137)
|
|
Created : | 2024-05-30 |
---|
Expires : | 2025-05-30 |
---|
Updated : | 2024-04-06 |
---|
|
|
|
Latest Events
|
|
 |
|
|
 |
Zenpay
Tradinghyips 30 minutes ago
removed |
paying
|
|
 |
Asuhour
Ishprash 30 minutes ago
removed |
paying
|
|
 |
|
|
 |
Stable Grow
Sqmonitor 8 hours ago
changed |
paying »
waiting
|
|
 |
Aitimart
Hyipclub 10 hours ago
changed |
paying »
waiting
|
|
 |
X2hour
Tradinghyips 14 hours ago
added |
paying
|
|
|