This «RiskRank» metric is a general litmus test for the quality of the «Life Time» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of life-time.pw and the results from 0 to 10 points.
life-time.pw good quality signs
Good hosting ensures the proper response level and excellent website access;
life-time.pw poor signs
Free SSL without a confidence guarantee;
Many design parts copied from other HYIPs;
IP 185.61.153.79 that occurs elsewhere for 59 HYIP;
Not listed on trusted HYIP monitors;
The website life-time.pw uses a not licenced script;
0.0
This project is a scam and stops paying on May 04, 2018.
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Content
#Tags
Here's what it says on the life-time.pw website:
www.life-time.pw is a global asset management firm founded in 2017
and manages a team of experienced managers, conducting deep fundamental
research to identify investments trading at material dislocation from
fair value. The key to the investment approach life-time.pw is expertise
in the identification and assessment of subsequent changes, as they are
often the catalyst for compelling opportunities.
www.life-time.pw is committed to provide a high annual return, adjusted
for risk throughout the investment cycle, capturing the greater part up
in strong markets and preserving capital in difficult markets.
life-time.pw believes that stock selection based on rigorous fundamental
analysis helps to generate positive results for a long time.
The investment team applies intensive analysis and research, to use the
innate inefficiency of the markets in which it operates. life-time.pw
seeks to identify undervalued investment opportunities, as well as
choose non-correlated and liquid investments that are selected for their
potential to generate alpha. Portfolio construction the strategy seeks
to reduce the impact of market volatility.
global asset management firm foundedinvestment team applies intensive analysisrigorous fundamental analysis helpsconducting deep fundamental researchidentify undervalued investment opportunitieshigh annual returnstock selection basedidentify investments tradinggenerate positive resultsinvestment approach lifeinvestment cyclecompelling opportunitiesgenerate alphaliquid investmentsmarket volatilitystrategy seeksgreater partpreserving capitalmaterial dislocationexperienced managersinnate inefficiencyportfolio constructionstrong marketsdifficult marketspw believespw seekslong timeteamresearchmarketspwlifetime
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here.
Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
232 views [2 clicks]
Domain:
Free SSL
valid for a 2 months - COMODO CA Limited 
Script: GoldCoders - Not Licensed
Found similar content
[design: 
