Check out HYIPs with HYIP.biz
Reviews+59 | Payouts+55 |  Blacklist+4 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 26 Apr 2024 23:52:37
Last Update: 26 Apr 2024 23:00:02
 
Join with: 
 
Hestia Advisory
0.0
Hestia Advisory
+
Added: Sep 11,2015 20:11
Closed: Sep 14,2015 [3 days]
Payment systems:
Features:
sslddos protection
Not Paying4
Plans: 52.5%-57.5% Daily for 2 days, principal included...
Min deposit: $10
Max deposit: $10000
Referral: 5%
Withdrawal: Instant
146 views [2 clicks] Reviews: 000
Domain: hestia-advisory.com is registered for a 4 years by TLD REGISTRAR SOLUTIONS LTD
[from Aug 10,2015 to Aug 10,2018]
+
Hosting: OVH Hosting, Inc. [ ovh.ca ] +
IP: 192.99.97.23 [not used in other projects]
Network: 192.99.x.x [714 projects] United States
+

Latest Reviews
Be first to add a vote/review and share your statement about "hestia-advisory.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ HyipCruiser 65
not paid
28 Sep 2015
$200 26%
52 USD
12 Sep 2015
8 years ago
problem » not paid
8 years ago
11 Sep 2015
8 years ago
+ UHyips 53
not paid
17 Sep 2015
$100 355%
355 USD
13 Sep 2015
8 years ago
problem » not paid
8 years ago
11 Sep 2015
8 years ago

Content
#Tags

Here's what it says on the hestia-advisory.com website:

"Angela Watkinson made me feel welcome and was focused on helping me. She saw all the hard work I was doing to fix my credit and worked to get me my loan. I was very grateful for the service I received. It was friendly and welcoming. Angela was fast at getting an answer for me and made my experience simple and fun." Sharon Y, Current Client at Hestia Advisory. "They got the job done with no stress at all. It was the first time putting my hard earned money under such high interest rate where I felt relaxed and did not feel pressured." Erin C, Current Client at Hestia Advisory. "I am extremely happy with the terms and interest rates offered. Both Angela and Jeremy provided assistance to me to navigate the requirements of the weekly deposit in a courteous and professional manner. In particular I would like to thank Angela for her help, from day one she has been helpful, friendly and more than anything patient through out the process. Cannot fault any aspect of the customer service provided especially follow up emails, of which there were many. I have no hesitation in recommending Hestia company to work colleagues, friends or family seeking finance. Please pass this feedback onto your team. Thanks again and have a great weekend." Arthur Wild, Current Client at Hestia Advisory. "Hi guys, I'd just like to say thank you so much for your assistance with this and the ongoing support in getting this finalized that you have provided. Hollie and I cannot show our thanks enough. Have an amazing weekend guys."Barbara Robinson, Current Client at Hestia Advisory. "To whom it may concern, I just wanted to express how happy I am with the way James has handled my finances and needs. He was extremely easy going, straight to the point and got the job done overnight! I have had nothing but trouble with banks so was a little weary about going through this finance but as soon as I spoke with James, all worries were out the window! I was referred by someone else who also was extremely happy with how James handles himself and the business he works for. You have a great employee on your hands. If I ever need any finance help again I will definitely be ringing James!"Yours sincerely, Lucy Clifford, Current Client at Hestia Advisory. "Hi Jeremy, Hope you had a good weekend. I just wanted to send a quick email to say 'Thank you' again for your time and patience with me during the course of acquiring finance for my recent garage purchase. You were very professional and open with any questions that I had no matter how often and trivial they may have been. Your efforts were greatly appreciated and I would not hesitate to recommend your services with Hestia to anyone. Please feel free to forward this on to your manager/supervisor as they should know about the awesome work you do. Have a great rest of the week - it's great to know that should I ever need further assistance, that I can rely on you. Much appreciated!"Kind regards, Christian Hammond, Current Client at Hestia Advisory. "Hi Angela, Just emailing to let you know I have picked up my twelve-core workstation PC and it is fabulous. I would like to thank you so much for your help with the high-interest rate deposit application and your patience. I feel you gave over and above your job description in helping me and really appreciate your assistance in every aspect of the process. Again thanks so much, I really felt like a valued customer every step of the way. Thanks again Keep up the great work!" Kind Regards, Kumbirai Gilbert Burgess, Current Client at Hestia Advisory. "Dear Angela It is really an immense pleasure for me that we have got tiles for verandah pavement with your efforts and I really appreciate your time and proper guidance. I assure you good references in the near future and confident to build our business relation even more stronger. Thanks once again!" Kuldeep Koenig, Current Client at Hestia Advisory.
Hestia Advisoryhighly flexible investment terms startingguaranteed fixed interest rateshestia instant withdrawal systeminterest rate deposit applicationinterest rates offeredcore workstation pckumbirai gilbert burgessinterest rates loweredaffordable entry depositjeremy birchwood explainedhard earned moneyrecent garage purchasehigh interest ratemade things easierday investment planrecommending hestia companyamazing weekend guysfamily seeking financegreat job communicatingcustomer service providedangela watkinson madejeremy provided assistanceinterest rategreat rateinvestment optiondays plantechnology offeredgood weekendweekly depositdeposit placementdeposit expirationgreat weekendvalued customeraverage customercustomer feelsverandah pavementipad airdear angelaitawesome workproper guidancechristian hammondfinancial advisorygreat restamazing experiencemonthly billsgood referencesimmense pleasurehigh levelquality studentsgreat workcurrent clientsfrugality coursesgood opportunitiescovering expenditurespatrick demetrioucustomer serviceteen badlycompletely satisfiedpatrai locationextremely easyjustin hiebertgeoffrey wilkinsoncurrent clientwithdraw buttonopening depositsbarbara robinsonshort hourscash flowprofit makinggreat employeerajkumar agarwalwork colleagueslucy cliffordoperation extendedarthur wildhard workkuldeep koenigheaven boonprivileged backgrounddiscover profitabilityfull hourlyquick emailtimely mannertrackability poweredhestia commercialhestia advisoryacquiring financejob descriptionongoing supportcontinued supportalyson workedfelt relaxedjeremy workedfinancial assistanceringing jamesgreatly appreciatedjames handlesextremely happydaily payoutscouldnâfast comparedneeded consultingmanager/supervisorgrowing concernexperience simplefantastic servicefeel freetime framefeel pressuredtime puttingbusiness relationkind behaviorprofessional mannerfantastic peoplefelt confidenttermsinvestmentdepositprovidedfamilylowereddaygreatcompanypurchasehardhighguysjeremyhestiaservicemadefinancejobsupportfantasticfeltworkedassistanceconcernneededdailyfastjamesâmanagerexperiencepeopleappreciatedconfidenthappytimeangelafeelkindprofessionalbusiness

Domain Information
#Whois
Host : hestia-advisory.com
Registrar : TLD REGISTRAR SOLUTIONS LTD

Nameservers :
a.ns.blockdos.com (162.159.24.6)
b.ns.blockdos.com (162.159.25.6)
c.ns.blockdos.com (162.159.26.6)
d.ns.blockdos.com (162.159.27.6)

Created :2015-08-10
Expires :2018-08-10
Updated :2015-08-25

Monitoring
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Vixus
1 hour ago
0.2
New HYIP Taplex
1 day ago
0.1
New HYIP Stablemomey
24 Apr 2024
3.5
New HYIP Aerobite
24 Apr 2024
0.2
New HYIP Pxm-Hour
24 Apr 2024
0.1
New HYIP Favometal
24 Apr 2024
0.1
New HYIP Bitmote Limited
23 Apr 2024
1.2
Latest Events
Recent event
Stablemomey
Eurohyips 1 hour ago
changed | waiting » paying
Recent event
Vixus
Sqmonitor 1 hour ago
added | paying
Recent event
Grizz-Ly
Uhyips 2 hours ago
changed | paying » problem
Recent event
Taplex
Hyipclub 13 hours ago
added | paying
Recent event
Vintal
Hyipclub 15 hours ago
added | paying
Recent event
Cfg Liberty
Hyipexplorer 15 hours ago
changed | waiting » paying
Recent event
Agros.au
Hyipclub 18 hours ago
changed | problem » not paid
Problematic HYIP & Scam
Best-Gold
Closed: 18 hours ago
Cryptonova
Closed: 18 hours ago
Hitbit
Closed: 18 hours ago
Auracasa Ltd
Closed: 18 hours ago
Valery Ai
Closed: 1 day ago
Dior-Hour
Closed: 1 day ago
Speed-Metal
Closed: 1 day ago
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback