Check out HYIPs with HYIP.biz
Reviews+12 | Payouts+19 |  Blacklist+4 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 26 Apr 2024 08:07:34
Last Update: 26 Apr 2024 08:00:02
 
Join with: 
 
Fantasticprofit
0.0
Fantasticprofit
+
Added: May 06,2015 14:10
Closed: Dec 31,2015 [239 days]
Payment systems:
Features:
ddos protection
Not Paying11
Plans: 200% after 1 day, 500% after 2 days, 1000% after 3 days
Min deposit: $20
Max deposit: $20000
Referral: 3%-10%
Withdrawal: Manual
699 views [4 clicks] Reviews: 000
Domain: fantasticprofit.com is registered for a 2 years by ENOM, INC.
[from Apr 22,2015 to Apr 22,2016]
+
IP: 118.139.186.1 [used in: 14 projects]
Network: 116.0.x.x [75 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "fantasticprofit.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ Bakster 79
not paid
08 Nov 2016
$250 12%
30 USD
12 Oct 2016
7 years ago
paying » not paid
7 years ago
27 May 2015
8 years ago
+ HyipCruiser 49
not paid
07 Jan 2016
$20 107%
21.4 USD
22 Dec 2015
8 years ago
waiting » problem
8 years ago
12 Jun 2015
8 years ago

Content
#Tags

Here's what it says on the fantasticprofit.com website:

FantasticProfit.com is a real paying online investment. Most of investors search real paying investment, and they often meet not pay programs often. You won't failed with us, FantasticProfit.com, we will pay all of our investors. Just 1 - 3 days you will know what we are and what you can get. We are a new investment fund on the market, but we have many years of experience in providing financial services in our country. Our company is a team of 30 people, of which 20 are experienced stock market investors. Our main activities are based on the Forex or stock market. We went to the internet, because we want to give you the opportunity to entrust your money for experts.We give a high way to make money easy. Your money will be increased in a express way in FantasticProfit.com. That's why we can make this highly roi back to all of our investors. The simple thing you need to do is releasing your money to us! We will express your money with a easy way and in some few days all of our investors will be a rich man as he want. We accept many e-currency & we have popular investors in internet. Join and Sign Up now then you can make money easy with us soon. In short time you can tell somebody others what we can bring to you.We only pay profits to the deposit account. And all of your money is safety with us! Please click deposit button then do the deposit step by step!After finish the deposit you can use your referral link to make more money and let more friends know us. We give upto 5% referral commissions. Responsive layout and attractive functional design Experienced fund manager & fast + efficient profits back Anti-DDOS Host & Full Time Payout Fully functional support and contact FantasticProfit.com is coming and launch today! We welcome all world's investors! We open 3 high roi plan for all of investors in the world. It will help all investors who like invest and get fast and high roi. And We use instant payment system for trustly in the world. FantasticProfit.com accept below e-currency for now: PerfectMoney, Okpay, Bitcoin and Payeer! Join us today then you will be get more rich tomorrow. moreMay-6-2015 06:08:16 AM.
Fantasticprofitattractive functional designexperienced fund manager &full time payoutfully functional supportinvestors search real paying investmentreal paying online investmentfast + efficient profits backantigive upto 5% referral commissionsexperienced stock market investorsddos host &providing financial servicesinstant payment systemhighly roi backclick deposit buttonhigh roi planinvestment fundmake money easyshort timestock marketinvestment poolcurrency &referral linkpay profitshigh roisimple thingdeposit accountresponsive layoutrich manrich tomorrowmain activitiespopular investorslaunch todaypay programsdeposit stepchoose fantasticprofitjoin fantasticprofitfastmarketeasymakegivehighdepositinvestorstodaypaycurrencystepmoneyjoinfantasticprofit

Domain Information
#Whois
Host : fantasticprofit.com
Registrar : ENOM, INC.

Nameservers :
ns49.domaincontrol.com (216.69.185.25)
ns50.domaincontrol.com (208.109.255.25)

Created :2015-04-22
Expires :2016-04-22
Updated :2015-04-27

Monitoring
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Taplex
17 hours ago
0.1
New HYIP Stablemomey
1 day ago
3.5
New HYIP Aerobite
1 day ago
0.2
New HYIP Pxm-Hour
1 day ago
0.1
New HYIP Favometal
1 day ago
0.1
New HYIP Bitmote Limited
23 Apr 2024
1.2
New HYIP Speed-Gain
23 Apr 2024
0.1
Latest Events
Recent event
Vintal
Hyipclub 11 minutes ago
added | paying
Recent event
Cfg Liberty
Hyipexplorer 12 minutes ago
changed | waiting » paying
Recent event
Agros.au
Hyipclub 3 hours ago
changed | problem » not paid
Recent event
Cryptomines
Hyipsinfo 3 hours ago
removed | problem
Recent event
Defi Profit Limited
Hyipsinfo 3 hours ago
removed | problem
Recent event
Pro Invest
Hyipsinfo 3 hours ago
removed | problem
Recent event
Top Invest Capital Ltd
Hyipsinfo 3 hours ago
removed | problem
Problematic HYIP & Scam
Best-Gold
Closed: 3 hours ago
Cryptonova
Closed: 3 hours ago
Hitbit
Closed: 3 hours ago
Auracasa Ltd
Closed: 3 hours ago
Valery Ai
Closed: 9 hours ago
Dior-Hour
Closed: 1 day ago
Speed-Metal
Closed: 1 day ago
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback