Plans: 34% hourly for 5 hours; 42% hourly for 5 hours; 56% hourly for...
Min deposit: $10
Max deposit: $100000
Referral: 10%
Withdrawal: instant
195 views [20 clicks]Reviews: 000
«Cryptobits» summary
This «RiskRank» metric is a general litmus test for the quality of the «Cryptobits» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of cryptobits.pw and the results from 0 to 10 points.
cryptobits.pw poor signs
Free SSL without a confidence guarantee;
Extra cheap hosting. The server has too many websites that share server resourses.
Many design parts copied from other HYIPs;
Much of the contents are similar to other HYIPs;
IP 162.0.229.13 that occurs elsewhere for 287 HYIP;
Not listed on trusted HYIP monitors;
The website cryptobits.pw uses a not licenced script;
0.1
0.0 - 0.9 Avoid HYIPs in this range, the worst of the worst. These are sites that show obvious signs of scam-like practices. We do not recommend investing in these sites, which are rife with scammers and bad HYIP practices. Many HYIPs in this group are labelled as "high risk" at the start.
Domain:
cryptobits.pw is registered for a 1 year
[from Dec 06,2020 to Dec 06,2021]
-
Free SSL valid for a 2 months - ZeroSSL
-
Script: GoldCoders - Not Licensed
-
Cheap price hosting
- 999 domains hosted on IP: 162.0.229.13
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Increase your affiliate commission most easily!
Content
#Tags
Here's what it says on the cryptobits.pw website:
cryptobits.pw is a global asset management firm founded in 2017 and
manages a team of experienced managers, conducting deep fundamental
research to identify investments trading at material dislocation from
fair value. The key to the investment approach cryptobits.pw is
expertise in the identification and assessment of subsequent changes, as
they are often the catalyst for compelling opportunities.
cryptobits.pw is committed to provide a high annual return, adjusted for
risk throughout the investment cycle, capturing the greater part up in
strong markets and preserving capital in difficult markets.
cryptobits.pw believes that stock selection based on rigorous
fundamental analysis helps to generate positive results for a long time.
The investment team applies intensive analysis and research, to use the
innate inefficiency of the markets in which it operates. cryptobits.pw
seeks to identify undervalued investment opportunities, as well as
choose non-correlated and liquid investments that are selected for their
potential to generate alpha. Portfolio construction the strategy seeks
to reduce the impact of market volatility.
global asset management firm foundedinvestment team applies intensive analysisrigorous fundamental analysis helpsconducting deep fundamental researchidentify undervalued investment opportunitiesidentify investments tradingstock selection basedhigh annual returngenerate positive resultsinvestment approach cryptobitsinvestment cyclecompelling opportunitiesgenerate alphaliquid investmentspreserving capitalportfolio constructionstrategy seekslong timeinnate inefficiencymarket volatilitygreater partexperienced managersmaterial dislocationstrong marketsdifficult marketspw believespw seeksteamresearchmarketspwcryptobits
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here.
Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.