|
|
Biteer
Added: Jan 22,2017 00:09
Closed: Apr 05,2017 [73 days]
|
Payment systems:
|
Features:
|
|
|
Plans: 1% - 1.2% daily for lifetime
Min deposit: $1
Max deposit: $∞
Referral: 8%**
Withdrawal: Automatic
|
|
502 views [5 clicks]
Reviews: 000
|
«Biteer» summaryThis «RiskRank» metric is a general litmus test for the quality of the «Biteer» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of biteer.biz and the results from 0 to 10 points.
biteer.biz good quality signs
- The domain biteer.biz is registered for two years, which is a good thing;
- Good hosting ensures the proper response level and excellent website access;
- The website content is unique;
- IP address not used by other HYIPs;
biteer.biz poor signs
- Free SSL without a confidence guarantee;
|
This project is a scam and stops paying on Apr 05, 2017.
|
Domain: |
biteer.biz is registered for a 2 years
by NEULEVEL [from Dec 04,2016 to Dec 03,2018]
|
|
+ |
PositiveSSL Multi-Domain
valid for a 5 months - COMODO CA Limited
|
- |
Hosting: Cloudflare, Inc. [ cloudflare.com ]
|
+ |
IP: 104.27.147.114 [not used in other projects]
Network: 104.16.x.x [5660 projects]
|
+ |
|
# |
Monitor |
#Pos. |
Status Updated |
Invested |
ROI(%) USD |
Last Payout |
Latest Event |
Added |
|
SQMonitor
|
90 |
not paid
03 Apr 2017
|
$65 |
59%
38.35 USD |
|
problem »
not paid7 years ago
|
22 Jan 2017
7 years ago
|
|
Incredible Earnings
|
58 |
not paid
25 Mar 2017
|
$40 |
156%
62.4 USD |
|
problem »
not paid7 years ago
|
23 Mar 2017
7 years ago
|
Here's what it says on the biteer.biz website:
2014 Baldwin founded the Biteer studio in University of Reading, 2
years in the use of self made electric energy to extract 10000 bitcoin,
and received a number of private mine owners to cooperate with the
invitation. in 2015 participated in the Singapore hosted the cloud
bitcoin World Conference and proposed an effective solution in the
meeting.
Biteer Limited in 2016 officially landed in London, and many of the
world's private mining cooperation. Biteer provides new energy
technologies and cloud computing for many mining. At the same time to
provide investors with private mining services. In order to improve
yield, 2017 we will build more "Super cloud mining", investors can get
good returns by investing Biteer, provide global services
Bitcoin mining can be an interesting experience, but sadly it seems
that small at home hobbyists are being outcompeted by large mining
farms. Two major issues facing those wishing to mine at home is the
cost of electricity and getting equipment in on time. Many of the large
farms make their own equipment, which gives them another advantage
because purchases from ASIC (application specific integrated
circuit) producers typically have long lead times. These ASICS are
computers that do one thing and one thing only: run the hash algorithm.
Mining today is dominated by these ASICS. Speed is shown in "hashes
per second." Many miners today generally operate in the terahash range,
with large farms operating in the petahash range. For
comparison, the speed of the entire bitcoin network at the
time of writing was 413.916 petahashes. You can see a more current
chart here. The total mining speed of the network influences
the difficulty of the blocks every 14 days. The network attempts to
compensate for the amount of processing power bitcoin has access to by
making it harder or easier, trying to keep the average time to find a
block at about 10 minutes. So as the global bitcoin hashing power
increases, the difficulty increases, which means earnings for the same
hashing power generally decline over time.
About every 10 minutes a new block is sent out into the network,
and the entire network enters what is essentially a big lottery. Mining
pools were created to make payouts more predictable. Miners combine
their hashing power under a pool, which has enough hashing
power to win the lottery on a more consistent basis than mining
alone. A pool that has 15% of the networks hashing power should win
15% of the time. The pool then divides up the earnings from the
block among individual miners based on their contribution, and there are
many different ways to do this. Click here for more
information on different payout systems.
Most methods are pretty fair, and in the long run all pools will
theoretically pay out about the same to you if given enough time.
The things to look out for are fees and whether or not they pay
transaction fees. Transaction fees vary by block, and are the
culmination of all of the fees that took place when that block was
created. Personally, I would place much more emphasis on the pool fee
when choosing. However, be aware that not all pools are trustworthy. For
example, I used Ghash.io for some time and for some reason the payouts
didn't seem to compare to other pools I had used. I've never
had any issues with Slush's pool or Antpool, and the average payout
per day is what it should be.
We offer the purchase of Bitcoin hashrate, you can
buy according to their own circumstances, the higher the hashrate, the
faster the speed of bitcoin mining (such as 1000GHS required investment
funds is 0.01bit coins, Bitcoin exploitation rate is 0.0001BTC / day or
so.)
Our daily dividend payment, in GMT AM9: 00-AM10:
00 paid by the system unified, members don’t need to manually
withdrawals, according to the daily bitcoin mining difficulty, the daily
range of income will be in the 1.0% -1.2%.
When we receive the member's Bitcoin (usually 1-3 hours, no more
than 24 hours), members will have the corresponding hashrate, the higher
the hashrate, bitcoin mining faster (such as 1000GHS The required
investment capital is 0.01 bitcoin, Bitcoin mining speed is 0.0001BTC /
day or so.)
The real bitcoin mining is not so high income, in the real
bitcoin mining, our earnings are the highest. We are not a rob Peter to
pay Paul game, this is a real Bitcoin mining investment plan.
Of course. For us, more people can join us to buy better and more
advanced Bitcoin mining equipment, so we welcome more people to join.
As a member, when you recommend a new member to join, you will get 8% of
the amount purchased by the member as a referral bonus.
We are the real Bitcoin mining company, we will
always update Bitcoin mining data, and according to mining difficulty,
to the members of the dividend, the daily earnings range is 1.0% -1.2%.
Biteer is a global cloud mining program, everyone can participate
in our mining plan, which also means that more people to join, can make
our mining efficiency greatly improved. In order to allow more people to
participate in our cloud mining program, we offer a high referral
bonus. Our referral bonus is 8%.provide global services bitcoin miningglobal bitcoin hashing power increasesreal bitcoin mining investment planapplication specific integrated circuitmining efficiency greatly improvedglobal cloud mining programbitcon cloud mining companyhashing power generally declineupdate bitcoin mining dataadvanced bitcoin mining technologyminers today generally operatereal bitcoin mining companycloud bitcoin world conferenceghs required investment fundsadvanced bitcoin mining equipmentdaily bitcoin mining difficultyprivate mining servicescloud mining programreal bitcoin miningrequired investment capitalsuper cloud miningnetworks hashing powerprocessing power bitcoinbitcoin mining companiesbitcoin mining platformslarge mining farmsprivate mining cooperationbitcoin exploitation ratelarge farms operatingindividual miners basedpay paul gamemade electric energylong lead timesentire bitcoin networkentire network entersbitcoin mining fasterlarge farms maketransaction fees varymajor issues facingprivate mine ownersdaily dividend paymentbitcoin mining speedtotal mining speedpay transaction feescurrent chart members don&rsquohigh referral bonusdaily earnings rangemining planhashing powerinvestment fundsmining bitcoinbitcoin miningmining todaydifficulty increasescloud computingmining difficultydaily rangeinitial investmentbitcoin addressminers combineprovide investorstheoretically payenergy technologiesreferral bonusmining poolsbitcoin hashratepetahash rangeterahash rangenetwork attemptsnetwork influencespayout systemseffective solutionpretty fairlong runbit coinsbiteer&rsquomake paymentsrob peter4 baldwin foundedsystem unifiedhigh incomeimprove yield6 officially landedpayouts didnautomatically withdrawinteresting experiencerevenue sharinghash algorithmsingapore hostedconsistent basisrevenue lowermailbox authenticationmanually withdrawalsprofit modelmake payoutsgood returnsaverage payoutproducers typicallyput membersminimum amountamount purchasedbig lotterybiteer studioinvesting biteerbiteer limitedhome hobbyistsbtc / dayclick outcompeted pool feeaverage timemeans earningsminingbitcoinghsdifficultynetworkworldissuesdividendfasterfeesmakeminespeedequipmentmembersdayamount5 btcearningsbiteerhome: runincomemeanslotteryinvestorshashratepools pooltime
|
Host : |
biteer.biz |
Registrar : |
NEULEVEL |
|
Nameservers : |
vera.ns.cloudflare.com (173.245.58.147)
graham.ns.cloudflare.com (173.245.59.171)
|
|
Created : | 2016-12-04 |
---|
Expires : | 2018-12-03 |
---|
Updated : | 2017-01-18 |
---|
|
|
|
Latest Events
|
|
|
Vilabit
Sqmonitor 2 hours ago
added |
paying
|
|
|
Hourlywoo
List4hyip 6 hours ago
added |
waiting
|
|
|
Rotor Finance
Fairmonitor 8 hours ago
changed |
paying »
not paid
|
|
|
Opteox
Fairmonitor 9 hours ago
added |
paying
|
|
|
|
|
|
|
|
|
Landhour
Ishprash 10 hours ago
added |
paying
|
|
|